ESTScan Details for Unigene SGN-U243019

Score 
615
Direction 
Forward
Predicted Peptide Sequence 
MADSSEGEEEGKLTGGSQQLVVDDDLREMGKKAAWSVSSYKPGNGVLSLRDDNLETYWQSDGAQPHLVNVQFQKKVKLQLVVLYVDFKLD
ESYTPGKISIRAGDGFHNLKEIKAVELVKPTGWMHISLSGNDPRETFVNTFMLQIGVLSNHLNGRDTHIRQIKVYGPRPNPIPLQPFQFT
STEFITYSAGDEAQGTIPRGKMPTIFIDIKMPNFAMKVX
Predicted Coding Sequence 
ATGGCGGATTCATCAGAGGGTGAGGAAGAAGGGAAACTAACAGGAGGAAGCCAGCAGTTAGTTGTGGATGATGATCTCCGGGAGATGGGT
AAAAAAGCAGCTTGGAGTGTCAGCTCTTATAAACCTGGCAATGGAGTTCTTTCACTTCGCGATGATAACCTTGAAACCTATTGGCAATCA
GATGGTGCACAGCCTCATCTTGTTAATGTTCAATTTCAGAAAAAAGTTAAGCTTCAATTAGTCGTCCTGTATGTTGATTTCAAGCTTGAC
GAAAGCTATACACCTGGTAAGATCTCTATCCGAGCAGGCGATGGCTTTCACAACTTGAAGGAGATAAAAGCAGTGGAACTTGTGAAGCCA
ACTGGATGGATGCATATATCTTTATCTGGTAATGATCCGCGTGAAACTTTTGTCAACACTTTCATGCTGCAAATAGGTGTGCTCTCGAAT
CATCTTAATGGAAGGGACACTCATATCCGCCAGATAAAAGTCTATGGGCCAAGACCGAACCCTATCCCTCTTCAGCCATTTCAGTTCACT
TCTACAGAGTTTATTACTTATTCTGCTGGAGATGAAGCTCAAGGGACTATCCCAAGAGGAAAGATGCCAACCATATTTATCGATATCAAA
ATGCCAAATTTTGCCATGAAAGTTAAX\
Edits in Original Sequence 
GGCTTAAT(5')ATGGCGGATTCATCAGAGGGTGAGGAAGAAGGGAAACTAACAGGAGGAAGCCAGCAGTTAGTTGTGGATGATGATCTC
CGGGAGATGGGTAAAAAAGCAGCTTGGAGTGTCAGCTCTTATAAACCTGGCAATGGAGTTCTTTCACTTCGCGATGATAACCTTGAAACC
TATTGGCAATCAGATGGTGCACAGCCTCATCTTGTTAATGTTCAATTTCAGAAAAAAGTTAAGCTTCAATTAGTCGTCCTGTATGTTGAT
TTCAAGCTTGACGAAAGCTATACACCTGGTAAGATCTCTATCCGAGCAGGCGATGGCTTTCACAACTTGAAGGAGATAAAAGCAGTGGAA
CTTGTGAAGCCAACTGGATGGATGCATATATCTTTATCTGGTAATGATCCGCGTGAAACTTTTGTCAACACTTTCATGCTGCAAATAGGT
GTGCTCTCGAATCATCTTAATGGAAGGGACACTCATATCCGCCAGATAAAAGTCTATGGGCCAAGACCGAACCCTATCCCTCTTCAGCCA
TTTCAGTTCACTTCTACAGAGTTTATTACTTATTCTGCTGtGAGATGAAGCTCAAGGGACTATCCCAAGAGGAAAGATGCCAACCATATT
TATCGATATCAAAATGCCAcAATTTTGCCATGAAAGTTAAX\(3')AAAGAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan