ESTScan Details for Unigene SGN-U243044

Score 
509
Direction 
Forward
Predicted Peptide Sequence 
FNGNIDEPLEDGDTALHXYLSVWPSGMCGATVRGGASVEAKDEDGAIPLHDACAGGYTEIARLLINNAPDPECVKRMLDTFDEEGDAPLH
HAARGEHLDVIRLLIASGASACRNNLLGRTPSELVEPESEACIILDEAISAEIGRPYRST
Predicted Coding Sequence 
TTTAATGGAAACATTGATGAACCTCTAGAAGATGGGGACACTGCTCTTCATXATTACTTGTCTGTATGGCCATCTGGCATGTGTGGAGCT
ACTGTTAGAGGAGGAGCTTCTGTGGAGGCTAAGGATGAAGATGGAGCAATTCCATTGCATGATGCTTGTGCTGGAGGATACACAGAAATA
GCCCGTCTGCTAATCAACAATGCACCTGACCCTGAATGCGTGAAAAGGATGCTGGACACCTTTGATGAAGAAGGTGATGCGCCTCTCCAT
CATGCCGCCAGAGGTGAACATTTAGATGTGATCAGATTATTGATAGCTTCAGGGGCTTCTGCTTGTAGGAACAATTTATTAGGAAGGACC
CCATCTGAGCTTGTTGAGCCTGAAAGTGAAGCTTGCATAATCTTAGACGAAGCTATAAGTGCTGAAATCGGCCGTCCCTATAGGTCTACG
TAA\
Edits in Original Sequence 
(5')TTTAATGGAAACATTGATGAACCTCTAGAAGATGGGGACACTGCTCTTCATXATTACTTGTCTGTATGGCCATCTGGCATGTGTGG
AGCTACTGTTAGAGaGAGGAGCTTCTGTGGAGGCTAAGGATGAAGATGGAGCAATTCCATTGCATGATGCTTGTGCTGGAGGATACACAG
AAATAGCCCGTCTGCTAATCAACAATGCACCTGACCCTGAATGCGTGAAAAGGATGCTGGACACCTTTGATGAAGAAGGTGATGCGCCTC
TCCATCATGCCGCCAGAGGTGAACATTTAGATGTGATCAGATTATTGATAGCTTCAGGGGCTTCTGCTTGTAGGAACAATTTATTAGGAA
GGACCCCATCTGAGCTTGTTGAGCCTGAAAGTGAAGCTTGCATAATCTTAGACGAAGCTATAAGTGCTGAAATCGGCCGTCCCTATAGGT
CTACGTAA\(3')GCTCGGCTATTGTCGATATGTTTCCCCTTGTTCTGTAGGTACTAGTGTTATATTAGAAACTCGGATATTATGCTTGA
ATGTTAAAATACTCTTTATATAGTGAGATTGCACATTGCAGTATGAGAAATACTCATCTTTTTTGAAGCGACTGTTAAATGATTCATCAA
CTAGAATTATAGAATATGGAAACTTTATTTGTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan