ESTScan Details for Unigene SGN-U243054

Score 
452
Direction 
Forward
Predicted Peptide Sequence 
KAASEVEEIGSSPLMTMINEIEEQTFDSSESFSLEIKERNLKTKKAKGKDIHTHSQIFKYAYAQLEREKAQQQQNNNLTFSGVISMATNT
DYKKRPVIEIGFKDLTVTLKGKRKHLLRSVNGKIMPGRITSVMGPSGAGKTTLLSALAGKTVGCTISGSILINGKSX
Predicted Coding Sequence 
AAAGCXGCATCTGAAGTAGAGGAAATAGGATCTAGTCCCCTGATGACGATGATTAATGAGATTGAAGAACAAACTTTTGATAGTTCGGAA
TCTTTCAGTTTGGAGATCAAAGAAAGAAATTTGAAAACCAAAAAGGCCAAAGGGAAAGATATTCATACTCATAGCCAAATCTTTAAGTAT
GCATATGCACAACTTGAGAGAGAAAAAGCTCAGCAACAGCAGAATAACAACCTTACTTTCTCTGGTGTAATCTCAATGGCCACAAATACT
GATTACAAGAAAAGACCTGTAATTGAGATAGGTTTTAAAGACTTAACTGTTACTTTGAAAGGAAAAAGGAAGCATCTGTTACGATCTGTT
AATGGAAAAATCATGCCTGGTCGTATTACTTCTGTCATGGGTCCATCAGGAGCAGGGAAAACTACTCTCCTTTCAGCTCTTGCAGGAAAA
ACTGTTGGATGTACAATTTCTGGTTCCATTCTTATAAATGGAAAATCAGXX\
Edits in Original Sequence 
(5')AAAGCXGCATCTGAAGTAGAGGAAATAGGATCTAGTCCCCTGATGACGATGATTAATGAGATTGAAGAACAAACTTTTGATAGTTC
GGAATCTTTCAGTTTGGAGATCAAAGAAAGAAATTTGAAAACCAAAAAGGCCAAAGGGAAAGATATTCATACTCATAGCCAAATCTTTAA
GTATGCATATGCACAACTTGAGAGAGAAAAAGCTCAGCAACAGCAGAATAACAACCTTACTTTCTCTGGTGTAATCTCAATGGCCACAAA
TACTGATTACAAGAAAAGACCTGTAATTGAGATAGGTTTTAAAGACTTAACTGTTACTTTGAAAGGAAAAAGGAAGCATCTGTTACGATC
TGTTAATGGAAAAATCATGCCTGGTCGTATTACTTCTGTCATGGGTCCATCAGGAGCAGGGAAAACTACTCTCCTTTCAGCTCTTGCAGG
AAAAACTGTTGGATGTACAATTTCTGGTTCCATTCTTATAAATGGAAAATCAGXX\(3')ATCAGAACCAATTCGTTCGTACAGAAAAAT
CG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan