ESTScan Details for Unigene SGN-U243161

Score 
999
Direction 
Forward
Predicted Peptide Sequence 
MGEMAENDEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPSVLKECRRIVADSEIMKEDDNNWPEPDRVGR
QELEIVMGNEHISFTTSKIGSLMDVQTSNDPEGLRIFYYLVQDLKCFVFSLISSISRLNPFNSFLWRMLNVAGCAQPHVLNVLNRVSKEM
VPFDGVVFFLNGGQVFVDVVFVSKDNCSCALYHHLSAYVCRIYRCIFVGHLCDNQHNQFLFTLWEDFGEIEGXPNFLKNGNRDRSTCNPW
KKYRNLYLSSLSLQTRYNSTVQLNPNYPQAVALSTATPSGQQLFSIGEISSAPSMGVFYAQAEMAILDEFQDFCVLECSVCKQKKRTKDR
KDFDCPRCNRKTSLVPRCSFQIDLIDNTATTTASISAELGKKLLSMTAEDIFDITCTKRQSLSLNHVHDMLSNTTFEIQLRKSSWSSSNT
TNATLSILSYMEKPHTALGTTDRTSKKIKPLEITEVELMPTTAAAGPSNAPAKFEPPTTYQKGVKGTTSHHFVTLAYPRDNIITHCPSTL
VFCISKITYAQANCCVLYICYTIPR
Predicted Coding Sequence 
ATGGGGGAAATGGCAGAGAATGACGAGTTTTACCTGAGATATTACGTGGGTCACAAAGGAAAATTCGGTCACGAGTTCTTAGAGTTTGAG
TTTAGGCCTGATGGCAAGCTCCGTTATGCTAACAATTCCAACTACAAGAACGATACAATGATTCGCAAGGAAGTCTTCCTTACCCCTTCT
GTTCTCAAAGAATGCCGCCGCATTGTTGCTGATAGCGAGATCATGAAGGAAGATGATAACAACTGGCCGGAACCAGATAGAGTTGGTAGA
CAGGAGCTTGAGATTGTGATGGGAAATGAACACATATCATTCACTACATCTAAGATTGGTTCATTAATGGATGTGCAGACCAGTAATGAT
CCCGAGGGACTTCGTATCTTCTATTATCTTGTTCAGGATCTGAAGTGTTTTGTGTTCTCTCTCATTTCCTCCATTTCAAGATTAAACCCA
TTTAACTCGTTCTTATGGCGTATGCTAAACGTTGCTGGATGTGCTCAGCCTCATGTTTTGAATGTGTTGAATCGTGTATCCAAAGAGATG
GTGCCGTTTGATGGTGTTGTGTTTTTTTTAAATGGTGGACAAGTCTTTGTAGACGTTGTTTTTGTGAGTAAAGATAACTGTTCGTGTGCT
CTTTACCATCATCTATCTGCATATGTTTGTCGAATCTATCGCTGTATATTTGTTGGTCATCTCTGTGACAATCAGCACAATCAGTTCCTC
TTCACTCTATGGGAGGATTTTGGAGAAATAGAAGGAXCACCAAATTTCCTCAAAAATGGCAACAGAGACAGATCTACTTGTAATCCTTGG
AAGAAGTATAGGAATCTCTACTTATCAAGCCTGTCACTGCAGACTAGGTACAACTCCACAGTACAGCTGAATCCAAATTATCCCCAAGCA
GTTGCACTCTCAACTGCCACCCCTTCTGGCCAACAACTTTTCTCTATTGGAGAAATCTCATCAGCACCTTCCATGGGAGTCTTTTATGCT
CAAGCAGAGATGGCCATATTAGATGAGTTCCAAGACTTCTGTGTGCTTGAATGCTCAGTATGCAAACAGAAGAAGCGAACAAAGGATAGA
AAGGATTTTGACTGTCCAAGATGCAATCGGAAAACATCATTAGTCCCTCGCTGTAGCTTCCAAATTGATCTTATTGACAATACTGCTACA
ACCACAGCATCTATCTCTGCTGAATTAGGAAAAAAGTTGCTTTCCATGACAGCAGAAGACATATTTGACATAACTTGCACTAAGCGACAA
TCATTGTCTCTTAATCATGTCCATGACATGCTGTCAAACACAACATTCGAAATTCAGCTAAGGAAGTCATCTTGGAGCAGCTCCAATACA
ACAAATGCAACTTTGTCCATTCTTTCCTACATGGAAAAACCCCATACTGCATTGGGCACTACAGATAGGACTTCTAAAAAAATCAAGCCT
TTGGAAATAACTGAAGTAGAACTGATGCCAACAACTGCTGCAGCTGGTCCTTCAAATGCACCTGCAAAATTTGAACCACCCACXACCTAC
CAAAAAGGTGTAAAAGGAACTACGTCACACCATTTTGTCACTCTTGCTTATCCTAGGGACAATATAATCACTCACTGTCCCTCAACTCTG
GTTTTTTGCATCAGCAAGATTACCTACGCACAGGCAAACTGCTGTGTCCTCTACATATGCTACACCATCCCACGCTAA\
Edits in Original Sequence 
GTTTAGACCTAAAAGGGAGTCGCCGTTGACACTGTATTCGGAAGAAGAGGGCAAACT(5')ATGGGGGAAATGGCAGAGAATGACGAGTT
TTACCTGAGATATTACGTGGGTCACAAAGGAAAATTCGGTCACGAGTTCTTAGAGTTTGAGTTTAGGCCTGATGGCAAGCTCCGTTATGC
TAACAATTCCAACTACAAGAACGATACAATGATTCGCAAGGAAGTCTTCCTTACCCCTTCTGTTCTCAAAGAATGCCGCCGCATTGTTGC
TGATAGCGAGATCATGAAGGAAGATGATAACAACTGGCCGGAACCAGATAGAGTTGGTAGACAGGAGCTTGAGATTGTGATGGGAAATGA
ACACATATCATTCACTACATCTAAGATTGGTTCATTAATGGATGTGCAGACCAGTAATGATCCCGAGGGACTTCGTATCTTCTATTATCT
TGTTCAGGATCTGAAGTGTTTTGTGTTCTCTCTCATTTCgCTCCATTTCAAGATTAAACCCATTTAACTCGTTCTTATGGCGTATGCTAA
ACGTTaGCTGGATGTGCTCAGCCTCATGTTTTGAATGTGTTGAATCGTGTATCCAAAGAGATGGTGCCGTTTGATGGTGTTGTGTTTTTT
TTAAATGtGTGGACAAGTCTTTGTAGACGTTGTTTTTGTGAGTAAAGATAACTGTTCGTGTGCTCTTTACCATCATCTATCTGCATATGT
TTGTCGAATCTATCGCTGTATATTTaGTTGGTCATCTCTGTGACAATCAGCACAATCAGTTCCTCTTCACTCTATGGGAGGATTTTGGAG
AAATAGAAGGAXCACCAAATTTCCTCAAAAATGGCAACAGAGACAGATCTACTTGTAATCCTTGGAAGAAGTATAGGAATCTCTACTTAT
CAAGCCTGTCACTGCAGACTAGGTACAACTCCACAGTACAGCTGAATCCAAATTATCCCCAAGCAGTTGCACTcCTCAACTGCCACCCCT
TCTGGCCAACAACTTTTCTCTATTGGAGAAATCTCATCAGCACCTTCCATGGGAGTCTTTTATGCTCAAGCAGAGATGGCCATATTAGAT
GAGTTCCAAGACTTCTGTGTGCTTGAATGCTCAGTATGCAAACAGAAGAAGCGAACAAAGGATAGAAAGGATTTTGACTGTCCAAGATGC
AATCGGAAAACATCATTAGTCCCTCGCTGTAGCTTCCAAATTGATCTTATTGACAATACTGCTACAACCACAGCATCTATCTCTGCTGAA
TTAGGAAAAAAGTTGCTTTCCATGACAGCAGAAGACATATTTGACATAACTTGCACTAAGCGACAATCATTGTCTCTTAATCATGTCCAT
GACATGCTGTCAAACACAACATTCGAAATTCAGCTAAGGAAGTCATCTTGGAGCAGCTCCAATACAACAAATGCAACTTTGTCCATTCTT
TCCTACATGGAAAAACCCCATACTGCATTGGGCACTACAGATAGGACTTCTAAAAAAATCAAGCCTTTGGAAATAACTGAAGTAGAACTG
ATGCCAACAACTGCTGCAGCTGGTCCTTCAAATGCACCTGCAAAATTTGAACCACCCACXACCTACCAAAAAGGTGTAAAAGGAACTACG
TCACACCATTTTGTCACTCTTGCTTATCCTAGGGACAATATAATCACTCACTGTCCCTCAACTCTGGTTTTTTGCATCAGCAAGATTACC
TACGCACAGGCAAACTGCTGTGTCCTCTACATATGCTACACCATCCCACGCTAA\(3')TCTTATCTGCGTAAACTGCAACATGTGCTAT
ATTATTTTGTTTATATTACATTCGTTAGTATGTACAAATCGTTAAACTTGACATCGCTGTTTTGTCTATTGTACATATTCTACATATTTC
TATTAGTACCTAATATAATAGATTATATTATCTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan