ESTScan Details for Unigene SGN-U243232

Score 
659
Direction 
Forward
Predicted Peptide Sequence 
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIF
VVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIANK
A
Predicted Coding Sequence 
ATGGGGTTGACATTCACCAAGCTTTTCAGCCGGCTATTTGCCAAGAAGGAAATGCGCATCCTCATGGTTGGACTCGATGCAGCTGGTAAG
ACCACCATATTGTACAAGCTCAAGCTGGGAGAAATTGTCACCACCATTCCAACTATTGGTTTCAATGTGGAAACTGTTGAATACAAGAAC
ATCAGCTTCACCGTTTGGGATGTCGGGGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTATTTCCAGAACACTCAGGGTCTCATTTTT
GTGGTTGATAGCAATGACAGAGACCGTGTAGTGGAGGCAAGAGATGAATTGCACAGGATGTTGAATGAGGATGAGCTTCGGGATGCTGTG
CTGCTTGTTTTTGCTAACAAACAAGATCTTCCTAATGCAATGAATGCTGCTGAAATAACCGATAAGCTTGGACTCCACTCCCTCAGGCAG
CGTCACTGGTACATCCAGAGCGCTTGTGCAACTTCTGGCGAGGGACTCTACGAGGGGCTTGATTGGCTTTCTAACAACATTGCCAATAAG
GCCTAA\
Edits in Original Sequence 
GTTATTCTCAAGCTCTCTCTCTCTCTCTCTGTCCTCTCGTGCTTTCTCTCACTAGATCCCTCTTTCCCAAACTGTTCTTCAGGGATCATT
AAGAAGAAAGAGAA
(5')ATGGGGTTGACATTCACCAAGCTTTTCAGCCGGCTATTTGCCAAGAAGGAAATGCGCATCCTCATGGTTGGA
CTCGATGCAGCTGGTAAGACCACCATATTGTACAAGCTCAAGCTGGGAGAAATTGTCACCACCATTCCAACTATTGGTTTCAATGTGGAA
ACTGTTGAATACAAGAACATCAGCTTCACCGTTTGGGATGTCGGGGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTATTTCCAGAAC
ACTCAGGGTCTCATTTTTGTGGTTGATAGCAATGACAGAGACCGTGTAGTGGAGGCAAGAGATGAATTGCACAGGATGTTGAATGAGGAT
GAGCTTCGGGATGCTGTGCTGCTTGTTTTTGCTAACAAACAAGATCTTCCTAATGCAATGAATGCTGCTGAAATAACCGATAAGCTTGGA
CTCCACTCCCTCAGGCAGCGTCACTGGTACATCCAGAGCGCTTGTGCAACTTCTGGCGAGGGACTCTACGAGGGGCTTGATTGGCTTTCT
AACAACATTGCCAATAAGGCCTAA\(3')GTCGAAGTAGAGTTGTTGCGGATTGATCCTGGATGCAGGCGGGTTTTTATCTAATTCCATT
TACTTTTATTACGTCTTTTTTCTTCTTCTTTTTCCAACATTCTCTGAATCTGTGTGGGTATGGCATTTGCTTCTTANGAGGTCACTTTTG
AAATGTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan