ESTScan Details for Unigene SGN-U243319

Score 
1310
Direction 
Forward
Predicted Peptide Sequence 
MAELLSNWSSTLEAVPPSHCIPVHERPSDTVEIVDTIPVIDLGKANGEERSAVVKDLLKAFEEYGFFQIINHGVPVDLMDEAMKVYKEFF
SLPAEEKAEYAKDAANDTNRGAATLYSSSAKHYDSEEHRYWRDVLEHSCNLDGKDKKTWPSNPPRYREVIGAYGDELRRVSKVILGLLAE
GLGLEAGFFDTELGQRMLVNHYPACPDPSLTLGVGGHCDPNLITIIQQEVYGLQILKDDKWIGVQPIQNAFVVNSGLPITVVSNGKLTSV
AHRVVTNTTHSRTSIGTFICPHDIVEPAKALVGPENPPQFKSFNWGIDFMPHYLSKKSVYHASLEPFKIDA
Predicted Coding Sequence 
ATGGCGGAGCTTCTCTCAAACTGGTCAAGCACATTAGAAGCAGTTCCTCCAAGTCATTGCATCCCAGTGCATGAAAGACCATCGGATACA
GTTGAAATTGTGGACACTATTCCAGTCATTGATTTGGGAAAAGCTAATGGTGAAGAACGAAGTGCTGTTGTTAAAGATCTTTTGAAAGCT
TTTGAAGAATATGGGTTTTTTCAGATAATCAATCATGGAGTACCCGTAGATCTAATGGATGAAGCAATGAAAGTGTACAAAGAATTTTTC
AGTCTGCCAGCAGAAGAGAAAGCAGAATATGCAAAGGATGCAGCTAATGATACAAATAGGGGTGCAGCTACACTGTACAGTAGCAGCGCT
AAGCATTATGATTCAGAGGAGCATCGTTACTGGAGAGATGTCTTGGAACATAGCTGCAATCTTGATGGAAAAGACAAAAAAACTTGGCCT
AGTAACCCTCCAAGATATAGGGAGGTTATTGGTGCATATGGAGATGAATTGAGAAGGGTGAGCAAAGTTATCTTGGGTCTGTTAGCTGAA
GGGCTAGGTTTGGAGGCAGGGTTCTTTGACACAGAACTTGGGCAGAGAATGCTTGTGAATCACTATCCAGCATGCCCAGATCCAAGTTTA
ACCTTGGGAGTTGGTGGACATTGTGATCCTAATCTCATAACCATTATCCAACAAGAAGTGTATGGTCTTCAAATATTGAAGGATGACAAA
TGGATTGGTGTGCAGCCTATCCAAAATGCATTTGTGGTCAATTCTGGTTTACCAATTACGGTAGTTAGCAATGGAAAGCTAACTAGTGTT
GCACATCGTGTGGTGACAAACACAACTCATTCACGAACCTCCATTGGTACTTTTATTTGCCCACACGATATTGTTGAACCTGCAAAAGCA
CTTGTTGGTCCGGAGAATCCTCCACAGTTCAAATCCTTTAATTGGGGAATTGATTTTATGCCACATTACCTCAGCAAGAAATCAGTTTAC
CACGCATCATTGGAGCCCTTCAAAATCGATGCTTAA\
Edits in Original Sequence 
GGACTTTGTTATGCAATTTTCTTCCCTATAAATGGCCCTCCATAGCTCAAATGAGATATCAGACAATTTAAAGAAGTACTATTAACATTT
AGAAGATTTCTTTCTTTCCCAGATTCATTGACA
(5')ATGGCGGAGCTTCTCTCAAACTGGTCAAGCACATTAGAAGCAGTTCCTCCAAG
TCATTGCATCCCAGTGCATGAAAGACCATCGGATACAGTTGAAATTGTGGACACTATTCCAGTCATTGATTTGGGAAAAGCTAATGGTGA
AGAACGAAGTGCTGTTGTTAAAGATCTTTTGAAAGCTTTTGAAGAATATGGGTTTTTTCAGATAATCAATCATGGAGTACCCGTAGATCT
AATGGATGAAGCAATGAAAGTGTACAAAGAATTTTTCAGTCTGCCAGCAGAAGAGAAAGCAGAATATGCAAAGGATGCAGCTAATGATAC
AAATAGGGGTGCAGCTACACTGTACAGTAGCAGCGCTAAGCATTATGATTCAGAGGAGCATCGTTACTGGAGAGATGTCTTGGAACATAG
CTGCAATCTTGATGGAAAAGACAAAAAAACTTGGCCTAGTAACCCTCCAAGATATAGGGAGGTTATTGGTGCATATGGAGATGAATTGAG
AAGGGTGAGCAAAGTTATCTTGGGTCTGTTAGCTGAAGGGCTAGGTTTGGAGGCAGGGTTCTTTGACACAGAACTTGGGCAGAGAATGCT
TGTGAATCACTATCCAGCATGCCCAGATCCAAGTTTAACCTTGGGAGTTGGTGGACATTGTGATCCTAATCTCATAACCATTATCCAACA
AGAAGTGTATGGTCTTCAAATATTGAAGGATGACAAATGGATTGGTGTGCAGCCTATCCAAAATGCATTTGTGGTCAATTCTGGTTTACC
AATTACGGTAGTTAGCAATGGAAAGCTAACTAGTGTTGCACATCGTGTGGTGACAAACACAACTCATTCACGAACCTCCATTGGTACTTT
TATTTGCCCACACGATATTGTTGAACCTGCAAAAGCACTTGTTGGTCCGGAGAATCCTCCACAGTTCAAATCCTTTAATTGGGGAATTGA
TTTTATGCCACATTACCTCAGCAAGAAATCAGTTTACCACGCATCATTGGAGCCCTTCAAAATCGATGCTTAA\(3')GCATTTGTGTGC
CAGAAGGATCAAGTCTATGCTGCTACTTTTAATTTCCACTAAAATAAGAGCTTTAATTTACAATGTCTTTCTAGTTTGTATCCTACCTTT
GTTACCTATTTCATGAATAAGAATCTTTCTTTCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan