ESTScan Details for Unigene SGN-U243464

Score 
467
Direction 
Forward
Predicted Peptide Sequence 
MESKFAHIIVFFLLATSFETLMARKESDGPEVIKLLKELESESWCKGKLFWPELIGVPTKLAKEIIEKENSLINDVQIILSGSPVPLDYR
CNRVRLVDNILGSVVQIPVVG
Predicted Coding Sequence 
ATGGAGTCAAAGTTTGCTCACATCATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAACTCTCATGGCAAGAAAAGAAAGTGATGGGCCA
GAAGTCATAAAACTTCTAAAGGAATTGGAATCTGAATCTTGGTGCAAAGGAAAACTATTCTGGCCAGAACTTATTGGTGTACCAACAAAG
CTTGCTAAGGAAATAATTGAGAAGGAAAATTCACTCATAAATGATGTTCAAATAATATTGAGTGGTTCTCCAGTCCCATTGGATTATCGT
TGTAATCGAGTTCGTCTTGTTGATAACATCTTGGGTTCTGTTGTACAAATTCCTGTGGTTGGTTAA\
Edits in Original Sequence 
TTACAACTAAAAGAAA(5')ATGGAGTCAAAGTTTGCTCACATCATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAACTCTCATGGCAA
GAAAAGAAAGTGATGGGCCAGAAGTCATAAAACTTCTAAAGGAATTGGAATCTGAATCTTGGTGCAAAGGAAAACTATTCTGGCCAGAAC
TTATTGGTGTACCAACAAAGCTTGCTAAGGAAATAATTGAGAAGGAAAATTCACTCATAAATGATGTTCAAATAATATTGAGTGGTTCTC
CAGTCCCATTGGATTATCGTTGTAATCGAGTTCGTCTTGTTGATAACATCTTGGGTTCTGTTGTACAAATTCCTGTGGTTGGTTAA\(3')
TTAATGGATTATTGAAGTAAGCAGCCACATGTCAAAAATAATTAGGGTTCATGTTGATTATAATGTCTTCATGTATTCTTATATATATG
TAATGGAATAAATAAGTGTGGCTTAATTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan