ESTScan Details for Unigene SGN-U243497

Score 
1311
Direction 
Forward
Predicted Peptide Sequence 
MGSSGGINYGSYTYENLEREPYWPSEKLRISITGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLADLRVMDNCLKVTK
GVDHVFNLAADMGGMGFIQSNHSVIFYNNTMISFNMMEAARINSVKRFFYASSACIYPEFKQLETNVSLKEADAWPAEPQDAYGLEKLAT
EELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTATDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGS
DEMVSMNEMAEMVLSFEDKKLAVQHIPGPEGVRGRNSDNTLIKEKLGWAPTMRLKDGLRITYFWIKEQIEKEKSQGVDTATYGSSKVVGT
QAPVELGSLRAADGKE
Predicted Coding Sequence 
ATGGGAAGCTCTGGTGGTATTAACTATGGTTCTTACACTTATGAGAATCTTGAGAGGGAACCTTACTGGCCATCTGAGAAACTCCGTATT
TCCATTACTGGGGCTGGAGGATTTATCGCTTCTCACATTGCTCGTCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCCGATTGGAAG
AAGAATGAGCACATGACAGAGGATATGTTCTGTCATGAGTTTCATCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAA
GGTGTTGACCATGTCTTCAATCTCGCTGCTGATATGGGTGGCATGGGTTTCATTCAGTCCAACCACTCGGTTATCTTCTATAACAACACT
ATGATCAGCTTCAATATGATGGAAGCTGCTAGGATTAACAGTGTCAAAAGGTTCTTCTATGCATCTAGTGCTTGCATATACCCCGAGTTC
AAACAACTCGAAACAAATGTCAGCCTGAAAGAAGCTGATGCTTGGCCTGCAGAGCCTCAAGATGCATACGGCTTGGAAAAGCTTGCCACA
GAAGAACTGTGCAAACATTACAACAAGGATTTTGGAATTGAATGTCGTATTGGAAGGTTCCATAACATCTATGGACCTTTTGGAACTTGG
AAAGGTGGAAGGGAAAAAGCTCCTGCCGCTTTTTGTAGAAAAGCACAAACTGCAACGGATAAGTTTGAAATGTGGGGAGATGGACTTCAA
ACACGTTCATTCACCTTCATTGATGAGTGTGTTGAAGGGGTTCTTAGATTGACAAAATCCGACTTCCGAGAGCCAGTGAACATAGGAAGT
GATGAGATGGTCAGCATGAATGAGATGGCTGAGATGGTTCTCAGCTTTGAGGACAAGAAGCTTGCTGTCCAACACATTCCAGGCCCAGAA
GGCGTCCGTGGTCGCAACTCAGACAACACACTGATAAAAGAGAAGCTTGGTTGGGCTCCAACAATGAGATTGAAGGATGGTCTGAGAATT
ACATACTTCTGGATCAAGGAGCAGATCGAGAAAGAGAAATCTCAAGGAGTTGATACTGCAACCTATGGATCTTCCAAGGTGGTGGGCACC
CAAGCTCCAGTTGAGCTAGGTTCCCTTCGTGCTGCTGATGGCAAGGAATAA\
Edits in Original Sequence 
AGAGTATGGTTTATGTGTCATCTTTCTCTCTCTCTATATATACCCAAATTCTTGTTATCATAATTGTCTCTCAACCGTTCAATTCTCTTT
CTAATATCTCTCCATTGCCTCAATCTTTTTCTCCTGCATACTTTTAGAGA
(5')ATGGGAAGCTCTGGTGGTATTAACTATGGTTCTTAC
ACTTATGAGAATCTTGAGAGGGAACCTTACTGGCCATCTGAGAAACTCCGTATTTCCATTACTGGGGCTGGAGGATTTATCGCTTCTCAC
ATTGCTCGTCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCCGATTGGAAGAAGAATGAGCACATGACAGAGGATATGTTCTGTCAT
GAGTTTCATCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAAGGTGTTGACCATGTCTTCAATCTCGCTGCTGATATG
GGTGGCATGGGTTTCATTCAGTCCAACCACTCGGTTATCTTCTATAACAACACTATGATCAGCTTCAATATGATGGAAGCTGCTAGGATT
AACAGTGTCAAAAGGTTCTTCTATGCATCTAGTGCTTGCATATACCCCGAGTTCAAACAACTCGAAACAAATGTCAGCCTGAAAGAAGCT
GATGCTTGGCCTGCAGAGCCTCAAGATGCATACGGCTTGGAAAAGCTTGCCACAGAAGAACTGTGCAAACATTACAACAAGGATTTTGGA
ATTGAATGTCGTATTGGAAGGTTCCATAACATCTATGGACCTTTTGGAACTTGGAAAGGTGGAAGGGAAAAAGCTCCTGCCGCTTTTTGT
AGAAAAGCACAAACTGCAACGGATAAGTTTGAAATGTGGGGAGATGGACTTCAAACACGTTCATTCACCTTCATTGATGAGTGTGTTGAA
GGGGTTCTTAGATTGACAAAATCCGACTTCCGAGAGCCAGTGAACATAGGAAGTGATGAGATGGTCAGCATGAATGAGATGGCTGAGATG
GTTCTCAGCTTTGAGGACAAGAAGCTTGCTGTCCAACACATTCCAGGCCCAGAAGGCGTCCGTGGTCGCAACTCAGACAACACACTGATA
AAAGAGAAGCTTGGTTGGGCTCCAACAATGAGATTGAAGGATGGTCTGAGAATTACATACTTCTGGATCAAGGAGCAGATCGAGAAAGAG
AAATCTCAAGGAGTTGATACTGCAACCTATGGATCTTCCAAGGTGGTGGGCACCCAAGCTCCAGTTGAGCTAGGTTCCCTTCGTGCTGCT
GATGGCAAGGAATAA\(3')GTTCATTCCTTCTGTCATCATTTCAACTGGAAGCCAATCCCTCTGCTATGACATTGCTGCATTATGTATT
ATGGCGTCGTAGAAGATGTGTTAAGTTCTGGTAATTGTTGGCTTTTCTTGGTTTTAGTTTGAACATGTCAATGTAATCTATTACCCCTTG
GTCTTGTGAAGGGGATGATAGTTTAATAGTATATTTATCAGTCGTTCGAGAAGATCTCAATGTGAGAATTGAATAACTGCCAGTGGATCC
TCTCTTGTTTTTTTTACCTAGTTCAGGATCTTGCTGTTGATGATCATGTAATCAAAATTTTAATCTTGTTAAGGTTTATATGTAAGATTT
CATTGCAAAGTTATTATTATCTCTTCAAAAAAAAAAAAAAAACCCCTTTTTGATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan