ESTScan Details for Unigene SGN-U243683

Score 
583
Direction 
Forward
Predicted Peptide Sequence 
PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYSSPPPPVKSPPPPVTTKQFEKLGHFPQPLK
FQFQYKISDGFLRRRLRVPWSNAINKKFNFAIERLIPSXLGPLYFYFSGFLIHIVLCESSRTVESGFHSLGGNRNYTSSVQFHMLLRYRN
Predicted Coding Sequence 
XCACCACCTTCACCTTCACCACCTCCACCTTATTACTACAAGTCTCCTCCACCACCTTCACCATCACCTCCACCACCATACTACTACAAA
TCACCACCACCCCCATCTCCATCACCACCACCTCCCTACTACTACCACTCTCCTCCTCCACCTGTGAAGTCTCCTCCTCCTCCATACTAC
TACAGCTCACCTCCCCCACCCGTAAAATCACCTCCCCCTCCAGTCACTACTAAGCAGTTCGAAAAGCTTGGCCATTTTCCACAACCACTC
AAATTTCAGTTTCAGTACAAAATAAGTGATGGGTTCTTGAGGAGAAGATTAAGAGTTCCATGGTCAAATGCAATTAATAAGAAGTTCAAC
TTTGCAATTGAGAGGTTGATTCCTAGTGXACTTGGACCACTTTACTTCTACTTCTCTGGTTTCCTTATTCACATTGTTCTCTGTGAGTCT
TCACGTACXGTGGAAAGTGGCTTCCACAGCTTAGGTGGAAATAGGAATTATACATCTAGCGTACAATTTCATATGTTGCTTCGTTATAGG
AATTGA\
Edits in Original Sequence 
(5')XCACCACCTTCACCTTCACCACCTCCACCTTATTACTACAAGTCTCCTCCACCACCTTCACCATCACCTCCACCACCATACTACTA
CAAATCACCACCACCCCCATCTCCATCACCACCACCTCCCTACTACTACCACTCTCCTCCTCCACCTGTGAAGTCTCCTCCTCCTCCATA
CTACTACAGCTCACCTCCCCCACCCGTAAAATCACCTCCCCCTCCAGTcCACTACTAAGCAGTTCGAAAAGCTTGGCCATTTTCCACAAC
CACTCAAATTTCAGTTTCAGTcACAAAATAAGTGATGGGTTCTTGAGGAGAAGATTAAGAGTTCCATGGTCAAATGCAATTAATAAGAAG
TTCAACTTTGCAATTGAGAGGTTGATTCCTAGTGXACTTGGACCACTTTACTTCTACTTCTCTGGTTTCCTTATTaCACATTGTTCTCTG
TGAGTCTTCACGTACXGTGGAAAGTGGCTTCCACAGCTTAGGTGGAAATAGGAATTATACATCTAGCGTACAATTTCATATGTTGCTTCG
TTATAGGAATTGA\(3')TTATTATTATTATTATGTATAGGCTTTGCAATGTGATTCGTTTGCTCTTAATTATTGTTGGCTGTCTCCTAA
GGCCTACTTGTGCTTTTGTGCACCAAATCAATAAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan