ESTScan Details for Unigene SGN-U243714

Score 
2020
Direction 
Forward
Predicted Peptide Sequence 
MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYVDLGCIIVSRKVFKWTVGCIIAAALIAGFVT
LIVKTVPKHRHHNPPPDNYTLALRKALMFFNAQRSGKLPKHNNVSWRGSSALQDGKSDGSTTFKNLVGGYYDAGDAIKFNFPQSFALTML
SWSVIEYPAKYEAAAELTHVKDIIKWGTDYLLKTFNSSADTIDRVVAQVGIGDTSGGPDPNDHYCWVRPEDIDYPRPVTECHSCSDLAAE
MAAALASASIVFKDNKVYSQKLVHGARTLFKFARVQRGRYSSGNEASIFYNSTSYWDEFVWGASWLYYATGNTSYLQLATTPGIAKHAGA
FWGGPDYGVFSWDNKLFGAQVLLSRLRLFLSPGYPYEEILSTFHNQTSIVMCSFLPFFTSFNRTKGGLIELNHGRPQPLQYVVNAAFLAT
LYSDYLAAADTPGWYCGPHFYSTDVLREFAQTQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDSSKPNPN
TLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNTIFSAVPPMFPTPPPPPAAGNHNLLIVAFINPSLXV
SIDSFFHNVVDMGFXAPRSLKQSKKQNEHLERTSFGSAWSRI
Predicted Coding Sequence 
ATGTACGGGAGGGATCCATGGGGAGGTGCATTAGAAATTAATGCAACAGATTCAGCTACTGATGATGATCGGAGCAGAAACTTACAGGAT
TTCGATAAAGCAGCTTTGTCACGAAATTTAGATGAAACGCAGCAAAGTTGGTTATTAGGTCCTACAGAGCAAAAGAAGAAGAAATATGTA
GATCTGGGTTGTATTATTGTTAGTAGAAAAGTATTCAAATGGACTGTCGGTTGTATTATTGCAGCTGCACTTATTGCTGGATTTGTTACT
CTTATTGTAAAAACTGTACCTAAGCACCGACACCATAATCCTCCACCAGATAACTACACTTTAGCTCTTCGTAAAGCTCTTATGTTCTTC
AATGCACAGCGCTCTGGGAAACTTCCTAAGCATAATAATGTGTCATGGAGGGGGAGTTCAGCTCTGCAGGATGGGAAATCGGATGGTTCG
ACTACGTTTAAGAATTTGGTTGGGGGTTATTATGATGCAGGAGATGCGATAAAGTTTAATTTCCCTCAATCTTTTGCTTTAACTATGTTG
AGTTGGAGTGTGATTGAGTATCCTGCAAAATATGAAGCTGCTGCAGAGCTCACTCATGTCAAGGATATTATCAAGTGGGGGACTGATTAT
CTCTTGAAAACATTCAATTCGTCAGCTGATACCATTGATCGAGTTGTTGCACAAGTGGGGATAGGGGATACTTCAGGAGGACCAGATCCC
AATGATCACTATTGTTGGGTGCGTCCAGAAGACATTGATTATCCACGGCCTGTAACTGAATGTCACAGTTGCTCGGATCTTGCTGCCGAG
ATGGCTGCTGCTCTGGCTTCTGCCTCGATTGTATTTAAGGATAACAAGGTGTACTCACAAAAGCTTGTCCATGGTGCTAGAACTTTGTTC
AAGTTTGCCAGGGTACAACGTGGTAGATACAGTAGCGGAAATGAAGCTTCAATTTTCTACAATTCGACTAGTTATTGGGATGAGTTTGTG
TGGGGTGCATCCTGGCTGTATTATGCTACAGGAAATACTTCATATCTTCAGCTTGCTACAACTCCTGGTATCGCCAAACACGCTGGTGCT
TTCTGGGGAGGTCCTGATTATGGCGTGTTCAGCTGGGATAATAAGCTCTTTGGAGCACAAGTGCTTCTAAGCCGTTTGAGATTGTTCTTG
AGCCCTGGATATCCTTATGAAGAAATTTTGAGTACATTTCATAACCAGACAAGCATAGTCATGTGCTCCTTCTTGCCATTCTTCACTTCA
TTTAATCGAACGAAAGGTGGGCTGATAGAGTTAAACCATGGAAGGCCTCAGCCACTTCAGTATGTAGTCAATGCTGCCTTCCTGGCTACC
TTGTATAGTGACTATCTTGCAGCTGCCGACACCCCTGGATGGTATTGTGGACCTCATTTCTACTCCACTGATGTCCTACGTGAATTTGCA
CAGACTCAGATCGACTATATCCTTGGCAAGAACCCCAGGAAAATGAGTTATGTTGTTGGCTTTGGCAATCACTATCCAAAACGTGTCCAC
CACCGAGGTGCATCAGTTCCTAAAAACAAGGTCAAGTATAATTGTAAAGGAGGATGGAAGTGGAGGGATTCATCTAAGCCTAATCCTAAT
ACTCTTGTTGGAGCCATGGTTGCTGGACCAGACAAGAATGATGGTTTCCATGATGTTCGTACTAATTACAATTATACCGAGCCAACACTT
GCCGGAAATGCCGGTTTGGTTGCAGCCCTCGTTGCTCTATCTGGAGATAAAAGTGTTGGAATTGACAAGAACACGATATTCTCTGCAGTA
CCACCCATGTTCCCTACTCCACCACCTCCGCCAGCTGCTGGAAACCATAATTTGTTGATCGTTGCTTTTATCAACCCCAGTCTTGXTGTG
TCCATAGATTCATTTTTTCATAATGTGGTTGATATGGGATTCXTGGCTCCGAGAAGTTTGAAGCAATCCAAGAAACAGAATGAGCACCTC
GAACGTACAAGCTTTGGCTCAGCCTGGTCTAGAATCTAG\
Edits in Original Sequence 
GCTATAGTGTCTTTGTCTACTAGCACAAGTGTCGGTGTCGGTGCCTTCAACTGTATATTTCCCACCAATATTCCAGCTTCATATACTCCA
CAACTCCATTATTACCCACTAACCTCACCCACTTTCCTCTTCCTTTAATAATTTCTCTCCCTCCCTTCACTACTGTTGAGCTCAAACAAT
CAACAATTCTCATTCTCTGAAAACTGTTTTTGTTTCTCAGT
(5')ATGTACGGGAGGGATCCATGGGGAGGTGCATTAGAAATTAATGCA
ACAGATTCAGCTACTGATGATGATCGGAGCAGAAACTTACAGGATTTCGATAAAGCAGCTTTGTCACGAAATTTAGATGAAACGCAGCAA
AGTTGGTTATTAGGTCCTACAGAGCAAAAGAAGAAGAAATATGTAGATCTGGGTTGTATTATTGTTAGTAGAAAAGTATTCAAATGGACT
GTCGGTTGTATTATTGCAGCTGCACTTATTGCTGGATTTGTTACTCTTATTGTAAAAACTGTACCTAAGCACCGACACCATAATCCTCCA
CCAGATAACTACACTTTAGCTCTTCGTAAAGCTCTTATGTTCTTCAATGCACAGCGCTCTGGGAAACTTCCTAAGCATAATAATGTGTCA
TGGAGGGGGAGTTCAGCTCTGCAGGATGGGAAATCGGATGGTTCGACTACGTTTAAGAATTTGGTTGGGGGTTATTATGATGCAGGAGAT
GCGATAAAGTTTAATTTCCCTCAATCTTTTGCTTTAACTATGTTGAGTTGGAGTGTGATTGAGTATCCTGCAAAATATGAAGCTGCTGCA
GAGCTCACTCATGTCAAGGATATTATCAAGTGGGGGACTGATTATCTCTTGAAAACATTCAATTCGTCAGCTGATACCATTGATCGAGTT
GTTGCACAAGTGGGGATAGGGGATACTTCAGGAGGACCAGATCCCAATGATCACTATTGTTGGGTGCGTCCAGAAGACATTGATTATCCA
CGGCCTGTAACTGAATGTCACAGTTGCTCGGATCTTGCTGCCGAGATGGCTGCTGCTCTGGCTTCTGCCTCGATTGTATTTAAGGATAAC
AAGGTGTACTCACAAAAGCTTGTCCATGGTGCTAGAACTTTGTTCAAGTTTGCCAGGGTACAACGTGGTAGATACAGTAGCGGAAATGAA
GCTTCAATTTTCTACAATTCGACTAGTTATTGGGATGAGTTTGTGTGGGGTGCATCCTGGCTGTATTATGCTACAGGAAATACTTCATAT
CTTCAGCTTGCTACAACTCCTGGTATCGCCAAACACGCTGGTGCTTTCTGGGGAGGTCCTGATTATGGCGTGTTCAGCTGGGATAATAAG
CTCTTTGGAGCACAAGTGCTTCTAAGCCGTTTGAGATTGTTCTTGAGCCCTGGATATCCTTATGAAGAAATTTTGAGTACATTTCATAAC
CAGACAAGCATAGTCATGTGCTCCTTCTTGCCATTCTTCACTTCATTTAATCGAACGAAAGGTGGGCTGATAGAGTTAAACCATGGAAGG
CCTCAGCCACTTCAGTATGTAGTCAATGCTGCCTTCCTGGCTACCTTGTATAGTGACTATCTTGCAGCTGCCGACACCCCTGGATGGTAT
TGTGGACCTCATTTCTACTCCACTGATGTCCTACGTGAATTTGCACAGACTCAGATCGACTATATCCTTGGCAAGAACCCCAGGAAAATG
AGTTATGTTGTTGGCTTTGGCAATCACTATCCAAAACGTGTCCACCACCGAGGTGCATCAGTTCCTAAAAACAAGGTCAAGTATAATTGT
AAAGGAGGATGGAAGTGGAGGGATTCATCTAAGCCTAATCCTAATACTCTTGTTGGAGCCATGGTTGCTGGACCAGACAAGAATGATGGT
TTCCATGATGTTCGTACTAATTACAATTATACCGAGCCAACACTTGCCGGAAATGCCGGTTTGGTTGCAGCCCTCGTTGCTCTATCTGGA
GATAAAAGTGTTGGAATTGACAAGAACACGATATTCTCTGCAGTACCACCCATGTTCCCTACTCCACCACCTCCGCCAGCTGCtTGGAAA
CCATAATTTGTTGATCGTTGCTTTTATCAACCCCAGTCTTGXTGTGTCCATAGATTCATTTTTTCATAATGTGGTTGATATGGGATTCXT
GGCTCCGAGAAGTTTGAAGCAATCCAAGAAACAGAATGAGCACCTCGAACGTACAAGCTTTGGCTCAGCCTGGTCTAGAATCTAG\(3')
ATGTAGAACTCCCTTTTTGAAGATGTGCTCAACGGCTTGCTTGTTATTTGCAACGTATCAATATATAGTGTTGTATGTATGTAACAAACC
AAACCAATGATATACTCATTGTAAACTGGAACATGAACTGCCTCAATATTTGTTGGATAGTTTTCAATAAATGTGCCACAGGTATGTGAT
CTTGATCTAGTGACATTTGTGAACACATAATTTTTTATCCAATTTAAGATGTTGCACCAAAAAAAAAAAAAAATTCGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan