ESTScan Details for Unigene SGN-U244015

Score 
710
Direction 
Forward
Predicted Peptide Sequence 
MSSFSEEQEALVVKSWGSMKKDAGEWGLKFFLKIFEIAPSAKKMFSFLKDSNVPLDQNPKLKVHAKSILVMTCEAAVQLRKAGKVVVRDS
TLKKIGATHFKYGVADEHFEVTKYALLETIKEASPEMWSVDMKNAWGEAYDQLVSAIKTEMK
Predicted Coding Sequence 
ATGAGTAGCTTTAGTGAAGAACAAGAAGCTTTGGTAGTTAAATCATGGGGGTCTATGAAGAAGGATGCTGGTGAATGGGGTCTCAAATTC
TTTCTCAAGATATTTGAAATAGCACCATCGGCAAAAAAGATGTTCTCATTCCTCAAAGATTCAAATGTGCCATTGGATCAAAATCCTAAG
CTCAAAGTTCATGCTAAATCTATCCTTGTCATGACTTGTGAAGCAGCAGTTCAACTTAGAAAAGCTGGAAAGGTTGTGGTGAGGGATTCC
ACTCTAAAAAAAATAGGTGCTACACATTTCAAGTATGGTGTGGCTGATGAGCATTTTGAGGTAACAAAATATGCCTTGTTGGAGACAATA
AAAGAAGCAAGTCCAGAAATGTGGAGTGTTGACATGAAGAATGCATGGGGAGAGGCCTATGATCAATTGGTTAGTGCTATCAAGACTGAG
ATGAAGTAG\
Edits in Original Sequence 
GTTGAGTTCCCTTATATAATTTTATTGTAAAGTTTGATCATCAATCATC(5')ATGAGTAGCTTTAGTGAAGAACAAGAAGCTTTGGTAG
TTAAATCATGGGGGTCTATGAAGAAGGATGCTGGTGAATGGGGTCTCAAATTCTTTCTCAAGATATTTGAAATAGCACCATCGGCAAAAA
AGATGTTCTCATTCCTCAAAGATTCAAATGTGCCATTGGATCAAAATCCTAAGCTCAAAGTTCATGCTAAATCTATCCTTGTCATGACTT
GTGAAGCAGCAGTTCAACTTAGAAAAGCTGGAAAGGTTGTGGTGAGGGATTCCACTCTAAAAAAAATAGGTGCTACACATTTCAAGTATG
GTGTGGCTGATGAGCATTTTGAGGTAACAAAATATGCCTTGTTGGAGACAATAAAAGAAGCAAGTCCAGAAATGTGGAGTGTTGACATGA
AGAATGCATGGGGAGAGGCCTATGATCAATTGGTTAGTGCTATCAAGACTGAGATGAAGTAG\(3')CTAACCTTCAAAATCCAATAAAA
TAAATAAATTTACATCCTCTTGTATAACAACAACAATAACATTAGTCTCGTAAATGGGGTCTGAAATCGAGAATATAATGTATGCATATC
TTATTTCTATTTTTTATGGAGTAGAAGGACTGATTCCGATGGACTATCGGCTCAAAATATTTTGTATTACTTTCAAAGTTTTGTAATCTA
ATTCGTGTGCTATGTCTTTTGTATATATGTATGGATTATTTAGTTTTTGTATTTTTGTATACATTATCTAAGGAGTTAATTTGGTGTAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan