ESTScan Details for Unigene SGN-U244031

Score 
357
Direction 
Forward
Predicted Peptide Sequence 
ARSRVLAFTRNQEAMPKSKRNRVVTLSKTKKKGKEHKENIVNSIRECAEKYSSAYVFSFENMRNLKFKEFRDQLKSSSRFFLGSNKVMQV
ALGRSDSDEIRPGLHKISKLVAAIQVFAXTNLSKEEVQRLFNGYEEHDFARTGTTATEKVELQEGPLDQFTHEMEPFLRKQGMPVRLNRG
VVELVSDFVVCEEGRPLSPEAARILRLLGKKMATFRLHLICRWSPDEFEIYREGLEESDIXILKTALRPHMFYNVKVMASGDTPXNLLLA
EVINGVLFYLVLRNITLTGHSFGNVKFGIQTSTQYGVMRFNYLIVQCNNSFGNVKFGIQTSTQYVCNAFELFDCSMQQIFM
Predicted Coding Sequence 
GCAAGAAGTAGGGTTTTAGCTTTCACAAGAAATCAAGAAGCAATGCCGAAGTCGAAGCGTAACAGAGTTGTTACCTTATCTAAGACGAAG
AAGAAGGGTAAGGAGCACAAAGAAAACATTGTCAACTCAATAAGGGAATGCGCGGAAAAGTATAGTTCAGCGTACGTATTTAGTTTCGAG
AACATGAGAAATCTCAAGTTCAAGGAGTTCAGAGATCAGCTCAAGTCTTCTAGCAGATTTTTCCTGGGATCGAACAAAGTCATGCAGGTA
GCACTAGGTCGGTCAGACTCTGATGAGATTCGTCCCGGCCTCCATAAGATTTCTAAGCTTGTCGCGGCGATTCAGGTCTTTGCTXTTACT
AACTTATCGAAGGAGGAGGTCCAAAGGTTGTTTAACGGGTATGAAGAACATGACTTTGCGAGGACTGGCACTACAGCAACTGAAAAGGTG
GAGCTACAAGAAGGTCCTCTTGATCAGTTCACACATGAGATGGAGCCATTCTTGCGGAAACAAGGGATGCCAGTGCGGTTGAACAGAGGT
GTCGTGGAGCTCGTGTCTGACTTTGTTGTATGTGAAGAAGGGAGGCCATTGTCACCAGAGGCAGCTCGGATACTGCGTCTGCTTGGTAAG
AAGATGGCTACTTTCCGGCTCCACTTAATATGCAGGTGGTCTCCTGATGAGTTTGAAATCTACAGAGAAGGATTGGAAGAATCAGATATT
GAXATCCTCAAGACTGCTCTCAGACCTCACATGTTTTACAATGTTAAAGTTATGGCATCTGGAGATACTCCTXATAACCTCTTGCTAGCT
GAAGTTATAAATGGAGTGCTTTTTTACTTGGTTCTCAGAAATATTACCTTGACCGGTCACAGTTTTGGCAATGTTAAATTTGGCATTCAG
ACCTCAACTCAGTATGGTGTTATGCGTTTCAATTATTTGATTGTTCAATGCAACAACAGTTTTGGCAATGTTAAATTTGGCATTCAGACC
TCAACTCAGTATGTGTGTAATGCGTTTGAATTATTTGACTGTTCAATGCAACAGATTTTTATGTAA\
Edits in Original Sequence 
(5')GCAAGAAGTAGGGTTTTAGCTTTCACAAGAAATCAAGAAGCAATGCCGAAGTCGAAGCGTAACAGAGTTGTTACCTTATCTAAGAC
GAAGAAGAAGGGTAAGGAGCACAAAGAAAACATTGTCAACTCAATAAGGGAATGCGCGGAAAAGTATAGTTCAGCGTACGTATTTAGTTT
CGAGAACATGAGAAATCTCAAGTTCAAGGAGTTCAGAGATCAGCTCAAGTCTTCTAGCAGATTTTTCCTGGGATCGAACAAAGTCATGCA
GGTAGCACTAGGTCGGTCAGACTCTGATGAGATTCGTCCCGGCCTCCATAAGATTTCTAAGCTTGTaCGCGGCGATTCAGGTCTTTGCTX
TTACTAACTTATCGAAGGAGGAGGTCCAAAGGTTGTTTAACGGGTATGAAGAACATGACTTTGCGAGGACTGGCACTACAGCAACTGAAA
AGGTGGAGCTACAAGAAGGTCCTCTTGATCAGTTCACACATGAGATGGAGCCATTCTTGCGGAAACAAGGGATGCCAGTGCGGTTGAACA
GAGGTGTCGTGGAGCTCGTGTCTGACTTTGTTGTATGTGAAGAAGGGAGGCCATTGTCACCAGAGGCAGCTCGGATACTGCGTCTGCTTG
GTAAGAAGATGGCTACTTTCCGGCTCCACTTAATATGCAGGTGGTCTCCTGATGAGTTTGAAATCTACAGAGAAGGATTGGAAGAATCAG
ATATTGAXATCCTCAtAGACTGCTCTCAGACCTCACATGTTTTACAATGTTAAAGTTATGGCATCTGGAGATACTCCTXATAACCTCTTG
CTAGCTGAAGTTATAAATGGAGTGCTTTTTTACTTGGTTCTCAGAAATATTACCTTGACCGGTCACAGTTTTGGCAATGTTAAATTTGGC
ATTCAGACCTCAACTCAGTATGtGTGTTATGCGTTTCAATTATTTGATTGTTCAATGCAACAACAGTTTTGGCAATGTTAAATTTGGCAT
TCAGACCTCAACTCAGTATGTGTGTAATGCGTTTGAATTATTTGACTGTTCAATGCAACAGATTTTTATGTAA\(3')AATCTTTTACTG
GTAGTATATCGTGGCAACTTCATAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan