ESTScan Details for Unigene SGN-U244182

Score 
1342
Direction 
Forward
Predicted Peptide Sequence 
MATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVKVLYTALCHTDAYTWSGKDPEGLFPCVLGHEAAGIVESVGEGVTEVQPGDH
VIPCYQAECRECKFCKSGKTNLCGKVRAATGVGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPAAPLEKVCLLGCGVP
TGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFDRAKNFGVTEFINPKEHEQPIQQVIVDLTDGGVDYSFE
CIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPSLVDKYLKKEIKVDEYITHNMTLADINK
AFDLMHDGDCLRVXPGYVCMNEVW
Predicted Coding Sequence 
ATGGCTACACAAGGTCAAGTCATCACCTGCAAAGCTGCGGTGGCCTGGGAACCCAACAAGCCTTTGGTGATTGAGGATGTGCAGGTGGCT
CCACCGCAAGCCGGTGAAGTTCGGGTTAAAGTTTTGTATACTGCTCTCTGCCATACCGATGCTTATACCTGGAGTGGCAAGGATCCTGAG
GGTCTCTTTCCATGTGTTCTTGGTCATGAGGCTGCAGGGATAGTAGAAAGTGTTGGTGAGGGAGTGACTGAGGTTCAGCCAGGAGACCAT
GTTATACCTTGCTACCAGGCAGAATGCAGAGAATGCAAGTTCTGCAAATCAGGAAAGACCAATCTTTGTGGTAAAGTAAGGGCTGCTACT
GGAGTGGGAGTTATGATGAACGACCGCAAGAGTCGATTTTCTATCAATGGAAAACCGATCTATCATTTCATGGGAACTTCAACCTTCAGT
CAGTACACTGTTGTCCATGATGTTAGTGTTGCAAAGATTGACCCAGCAGCTCCTCTGGAGAAAGTCTGCCTTCTCGGGTGTGGTGTTCCA
ACTGGCCTTGGAGCTGTTTGGAACACTGCAAAAGTTGAACCCGGTTCCATTGTTGCCGTCTTTGGCCTGGGAACAGTTGGTCTTGCTGTG
GCGGAGGGTGCAAAAGCTGCTGGTGCTTCACGAATTATTGGAATTGATATTGACAGCAAAAAGTTCGATAGAGCCAAAAATTTTGGTGTG
ACTGAATTCATCAATCCCAAGGAGCATGAGCAACCCATTCAGCAAGTCATTGTGGATCTTACAGATGGTGGTGTTGATTACAGTTTTGAG
TGCATAGGAAATGTCTCTGTTATGAGGGCTGCTTTAGAGTGTTGTCACAAGGGTTGGGGAACCTCAGTGATTGTAGGTGTTGCTGCTTCT
GGTCAGGAGATATCTACACGTCCATTTCAGCTGGTAACTGGTCGTGTTTGGAAGGGAACTGCTTTTGGTGGTTTCAAAAGCCGATCACAA
GTTCCTTCCCTCGTGGACAAGTATTTAAAGAAGGAAATCAAGGTGGATGAATACATCACTCATAACATGACACTTGCGGACATAAACAAA
GCTTTTGACCTGATGCATGACGGGGACTGCCTCCGTGTTGXTCCTGGATATGTTTGTATGAACGAAGTCTGG\
Edits in Original Sequence 
TTGCATTTAGCTGTAGACTCATCTTCTTTAAAGCACTATTTTATTTTCTTTGATTCTGTGGTCTGTAAATC(5')ATGGCTACACAAGGT
CAAGTCATCACCTGCAAAGCTGCGGTGGCCTGGGAACCCAACAAGCCTTTGGTGATTGAGGATGTGCAGGTGGCTCCACCGCAAGCCGGT
GAAGTTCGGGTTAAAGTTTTGTATACTGCTCTCTGCCATACCGATGCTTATACCTGGAGTGGCAAGGATCCTGAGGGTCTCTTTCCATGT
GTTCTTGGTCATGAGGCTGCAGGGATAGTAGAAAGTGTTGGTGAGGGAGTGACTGAGGTTCAGCCAGGAGACCATGTTATACCTTGCTAC
CAGGCAGAATGCAGAGAATGCAAGTTCTGCAAATCAGGAAAGACCAATCTTTGTGGTAAAGTAAGGGCTGCTACTGGAGTGGGAGTTATG
ATGAACGACCGCAAGAGTCGATTTTCTATCAATGGAAAACCGATCTATCATTTCATGGGAACTTCAACCTTCAGTCAGTACACTGTTGTC
CATGATGTTAGTGTTGCAAAGATTGACCCAGCAGCTCCTCTGGAGAAAGTCTGCCTTCTCGGGTGTGGTGTTCCAACTGGCCTTGGAGCT
GTTTGGAACACTGCAAAAGTTGAACCCGGTTCCATTGTTGCCGTCTTTGGCCTGGGAACAGTTGGTCTTGCTGTGGCGGAGGGTGCAAAA
GCTGCTGGTGCTTCACGAATTATTGGAATTGATATTGACAGCAAAAAGTTCGATAGAGCCAAAAATTTTGGTGTGACTGAATTCATCAAT
CCCAAGGAGCATGAGCAACCCATTCAGCAAGTCATTGTGGATCTTACAGATGGTGGTGTTGATTACAGTTTTGAGTGCATAGGAAATGTC
TCTGTTATGAGGGCTGCTTTAGAGTGTTGTCACAAGGGTTGGGGAACCTCAGTGATTGTAGGTGTTGCTGCTTCTGGTCAGGAGATATCT
ACACGTCCATTTCAGCTGGTAACTGGTCGTGTTTGGAAGGGAACTGCTTTTGGTGGTTTCAAAAGCCGATCACAAGTTCCTTCCCTCGTG
GACAAGTATTTAAAGAAGGAAATCAAGGTGGATGAATACATCACTCATAACATGACACTTGCGGACATAAACAAAGCTTTTGACCTGATG
CATGACGGGGACTGCCTCCGTGTTGXTCCTGGATATGTTTGTATGAACGAAGTCTGG\(3')AGGCACTTTATGTTGCTGACTTTCTGTT
TTTGTGCTATTTATCGGACACTATTTCCCTTTCCCCTTCCCCTTCCTAATTGTATGTGTGGAATAAAAAGAAAGTAAGAAAAAAAGGATC
CATGGGACGGATGAACTCTTTTTAAATGGATGCTATTTTATTATCTTTTCAACTAAAAAAAAAAAAAAAAAAAACTCGAGAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan