ESTScan Details for Unigene SGN-U244392

Score 
1396
Direction 
Forward
Predicted Peptide Sequence 
GGXKKTPTTVTEVEEEKTRRVDEVAAAADTHGILLYCANYAIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITCSGNR
VTEIKISRLGLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTSLRYLNVSHNQIQGQVTVAFD
SLSSLDTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQFTGTIDILANLPLDDLNVENNRFTGWVPDHLKGITKSNGNSWNSGSAPPPPP
GTPPASRPHHKSGGNNSPTDGASSGDGGGKSGIGGGAIAGIVISVLVVGAIVAFFVIKKRLKRSSTDIERHDNQPFAPLAPPQEVYELKT
NEASSAPIVKVFEAPAVVNLRPPPIERHKSFDEVDIAAKPIVPPKKVNTAKIDARQYSIADLQMATDSFNVDNLIGEGSFGRVYRAQFDD
GKVLAVKKINSSALQNPEDFLDIVSEISRLHHPNVTELVGYCSEHGQHLLVYEFHKNGSLHDFLHLSDEESKPLTWNSRVKIALGTARAL
EYLHEVCSPSLVHKNIKSANIVLDAELNPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVTAFGGGYVGNFLTGRKPF
DSDKKQDSE
Predicted Coding Sequence 
GGTGGTGXAAAGAAAACTCCGACGACTGTGACTGAGGTGGAAGAGGAGAAAACACGCCGTGTAGATGAGGTTGCTGCTGCTGCCGATACT
CATGGCATTTTGCTTTATTGTGCTAATTATGCCATTGCCGACACAGATCCAAATGACGCATCTGCTCTGAGAGTTCTGTATAGCAGCCTA
AATTCACCTGGACAGCTAACAAAATGGAATGCCAATGGTGGTGATCCTTGTGGAGAGTCCTGGACAGGTATTACTTGCTCGGGCAATAGA
GTTACTGAAATCAAGATATCACGTCTTGGACTCTCTGGTTCACTGGGCTACCAATTAGCAAGTCTTACATCGGTGACTAATTTTGACATA
AGCAATAACAATTTGGGAAACCAGTTACCTTATCAGCTTCCTCCAAATGTGCAAAGATTAAACCTTGCTGCTAATGGTTTTAATGGTGCC
CTTCCATATTCCGTTTCGCAGATGACTTCCCTCCGATACTTAAATGTCAGTCATAATCAAATTCAAGGACAAGTGACTGTCGCGTTCGAC
TCTCTGTCTTCTCTCGATACATTGGATTTCTCATTCAATGCTATGACGGGTGATCTTCCTCAAAGCTTCAAGGCACTGACTAGTATGAAT
AAAATGTATTTGCAGAACAACCAGTTTACAGGAACTATTGATATCTTAGCCAATCTTCCTCTTGATGATTTGAATGTTGAGAACAACCGT
TTTACTGGCTGGGTTCCTGATCACTTGAAAGGGATCACGAAATCAAATGGTAACTCATGGAACTCAGGATCTGCACCCCCTCCTCCACCT
GGCACACCCCCTGCAAGCAGGCCGCACCACAAATCTGGAGGCAATAATAGCCCTACTGATGGTGCAAGCAGTGGTGATGGTGGTGGTAAA
TCGGGGATAGGGGGTGGAGCCATTGCAGGCATAGTGATATCTGTTCTAGTTGTTGGGGCAATTGTAGCGTTCTTTGTTATCAAGAAGAGA
TTGAAGCGGTCATCGACGGACATTGAGAGACATGATAATCAGCCATTTGCTCCTCTTGCTCCCCCCCAGGAAGTATATGAATTGAAAACT
AATGAAGCTTCCTCTGCGCCAATAGTGAAAGTATTTGAAGCTCCTGCAGTAGTAAATCTAAGACCTCCACCTATTGAACGCCACAAGTCA
TTTGACGAAGTTGACATAGCAGCAAAACCAATTGTCCCACCCAAGAAAGTTAATACAGCTAAAATAGATGCAAGACAATATTCAATCGCA
GACCTACAGATGGCGACTGATAGCTTCAATGTTGATAACCTTATTGGCGAGGGATCATTTGGGCGTGTTTATAGGGCTCAGTTCGATGAT
GGAAAGGTTCTTGCAGTCAAGAAAATCAACTCTTCTGCACTCCAGAATCCTGAAGATTTTCTCGATATTGTTTCTGAGATATCACGGTTG
CACCATCCAAATGTTACTGAGCTGGTTGGATATTGTTCAGAGCACGGGCAGCATCTGCTGGTTTATGAATTCCACAAAAATGGTTCTCTG
CATGATTTCCTGCATCTGTCAGATGAGGAAAGCAAGCCTCTAACATGGAATAGCCGAGTTAAGATTGCACTAGGCACAGCAAGAGCACTA
GAGTATCTGCACGAAGTTTGTTCACCATCTTTGGTTCACAAGAATATCAAGTCTGCAAATATTGTACTTGATGCAGAACTCAATCCTCAT
CTATCAGACTGTGGATTGGCAAGTCTAATTGCTGATGCAGATCAGGCATTGAACCATAATACAGGATCGGGATATGGTGCCCCCGAAGTT
GCTATGTCCGGACTCTGTACCATAAAAAGTGATGTGACAGCCTTTGGAGGTGGTTATGTTGGGAACTTCTTAACGGGACGAAAACCTTTT
GATAGCGACAAGAAACAAGATTCTGAA\
Edits in Original Sequence 
(5')GGTGGTGXAAAGAAAACTCCGACGACTGTGACTGAGGTGGAAGAGGAGAAAACgACGCCGTGTAGATGAGGTTGCTGCTGCTGCCG
ATACTCATcGGCATTTTGCTTTATTGTGCTAATTATGCCATTGCCGACACAGATCCAAATGACGCATCTGCTCTGAGAGTTCTGTATAGC
AGCCTAAATTCACCTGGACAGCTAACAAAATGGAATGCCAATGGTGGTGATCCTTGTGGAGAGTCCTGGACAGGTATTACTTGCTCGGGC
AATAGAGTTACTGAAATCAAGATATCACGTCTTGGACTCTCTGGTTCACTGGGCTACCAATTAGCAAGTCTTACATCGGTGACTAATTTT
GACATAAGCAATAACAATTTGGGAAACCAGTTACCTTATCAGCTTCCTCCAAATGTGCAAAGATTAAACCTTGCTGCTAATGGTTTTAAT
GGTGCCCTTCCATATTCCGTTTCGCAGATGACTTCCCTCCGATACTTAAATGTCAGTCATAATCAAATTCAAGGACAAGTGACTGTCGCG
TTCGACTCTCTGTCTTCTCTCGATACATTGGATTTCTCATTCAATGCTATGACGGGTGATCTTCCTCAAAGCTTCAAGGCACTGACTAGT
ATGAATAAAATGTATTTGCAGAACAACCAGTTTACAGGAACTATTGATATCTTAGCCAATCTTCCTCTTGATGATTTGAATGTTGAGAAC
AACCGTTTTACTGGCTGGGTTCCTGATCACTTGAAAGGGATCACGAAATCAAATGGTAACTCATGGAACTCAGGATCTGCACCCCCTCCT
CCACCTGGCACACCCCCTGCAAGCAGGCCGCACCACAAATCTGGAGGCAATAATAGCCCTACTGATGGTGCAAGCAGTGGTGATGGTGGT
GGTAAATCGGGGATAGGGGGTGGAGCCATTGCAGGCATAGTGATATCTGTTCTAGTTGTTGGGGCAATTGTAGCGTTCTTTGTTATCAAG
AAGAGATTGAAGCGGTCATCGACGGACATTGAGAGACATGATAATCAGCCATTTGCTCCTCTTGCTCCCCCCCAGGAAGTATATGAATTG
AAAACTAATGAAGCTTCCTCTGCGCCAATAGTGAAAGTATTTGAAGCTCCTGCAGTAGTAAATCTAAGACCTCCACCTATTGAACGCCAC
AAGTCATTTGACGAAGTTGACATAGCAGCAAAACCAATTGTCCCACCCAAGAAAGTTAATACAGCTAAAATAGATGCAAGACAATATTCA
ATCGCAGACCTACAGATGGCGACTGATAGCTTCAATGTTGATAACCTTATTGGCGAGGGATCATTTGGGCGTGTTTATAGGGCTCAGTTC
GATGATGGAAAGGTTCTTGCAGTCAAGAAAATCAACTCTTCTGCACTCCAGAATCCTGAAGATTTTCTCGATATTGTTTCTGAGATATCA
CGGTTGCACCATCCAAATGTTACTGAGCTGGTTGGATATTGTTCAGAGCACGGGCAGCATCTGCTGGTTTATGAATTCCACAAAAATGGT
TCTCTGCATGATTTCCTGCATCTGTCAGATGAGGAAAGCAAGCCTCTAACATGGAATAGCCGAGTTAAGATTGCACTAGGCACAGCAAGA
GCACTAGAGTATCTGCACGAAGTTTGTTCACCATCTTTGGTTCACAAGAATATCAAGTCTGCAAATATTGTACTTGATGCAGAACTCAAT
CCTCATCTATCAGACTGTGGATTGGCAAGTCTAATTGCTGATGCAGATCAGGCATTGAACCATAATACAGGATCGGGATATGGTGCCCCC
GAAGTTGCTATGTCCGGACTCTGTACCATAAAAAGTGATGTGtACAGCCTTTGGAGGTGGTTATGTTGGGAACTTCTTAACGGGACGAAA
ACCTTTTGATAGCGACAAGAAACAAGATTCTGAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan