ESTScan Details for Unigene SGN-U244473

Score 
215
Direction 
Forward
Predicted Peptide Sequence 
FLLHRRSQERVLKSGTEKKWQAREKLTPTFRXDLKLPGFVPLFLSQSEIVGVMASHPYWLWCSCGYSQGLFLNYQRLTGCSCAGGFSXGL
THMVLEGYFVFTPDFYQKTSPVYLAEVWKEYSKGDSRYVGRDAAVLSVEGVTAVIEGPACLLAVYAIATKKAYRHVLQLSICLGQLYGTA
IYFITAVLEGDNFSTSPFYYYAYYVFANHFWVWIPSLIVIHCWKKICAAVNVHEQKTKTR
Predicted Coding Sequence 
XXTTTTCTTCTTCATCGCCGATCACAGGAAAGGGTCCTTAAGTCAGGCACTGAGAAAAAATGGCAAGCCAGGGAGAAGCTCACCCCTACG
TTCCGCXATGATCTAAAATTGCCTGGTTTTGTTCCCCTATTCCTCTCACAGTCAGAAATTGTTGGTGTTATGGCATCTCATCCTTACTGG
TTGTGGTGTTCATGTGGATATTCTCAGGGTTTGTTCCTAAATTATCAAAGACTGACAGGGTGCTCATGTGCTGGTGGATTTTCACXGGGC
CTAACCCACATGGTCCTTGAGGGATATTTCGTTTTTACTCCAGATTTCTACCAAAAGACTAGTCCTGTTTACCTTGCTGAAGTCTGGAAA
GAATACAGCAAAGGTGATTCAAGATACGTAGGCCGAGATGCTGCAGTTCTTAGTGTTGAAGGGGTCACAGCTGTCATAGAGGGGCCAGCA
TGCCTTCTTGCAGTGTATGCTATAGCTACTAAGAAGGCATACAGGCACGTACTTCAACTATCCATTTGTTTGGGGCAGCTCTATGGCACG
GCTATATACTTCATAACAGCTGTCTTGGAAGGCGACAATTTTTCTACAAGCCCCTTCTATTACTACGCTTACTATGTCTTTGCAAATCAT
TTCTGGGTTTGGATACCAAGTCTCATAGTGATCCACTGCTGGAAGAAAATATGTGCTGCTGTCAACGTCCACGAGCAGAAGACCAAGACC
CGCTGA\
Edits in Original Sequence 
(5')XXTTTTCTTCTTCATCGCCGATCACAGGAAAGGGTCCTTAAGTCAGGCACTGAGAAAAAATGGCAAGCCAGGGAGAAGCTCACCCC
TACGTTCCGCXATGATCTAAAATTGCCTGGTTTTGTTCCCCTATTCCTCTCACAGTCAGAAATTGTTGGTGTaTATGGCATCTCATCCTT
ACTGGTTGTGGTGTTCATGTGGATATTCTCAGGGTTTGTTCCTAAATTATCAAAGACTGACAGGGTGCTCATGTGCTGGTGGATTTTCAC
XGGGCCTAACCCACATGGTCCTTGAGGGATATTTCGTTTTTACTCCAGATTTCTACCAAAAGACTAGTCCTGTTTACCTTGCTGAAGTCT
GGAAAGAATACAGCAAAGGTGATTCAAGATACGTAGGCCGAGATGCTGCAGTTCTTAGTGTTGAAGGGGTCACAGCTGTCATAGAGGGGC
CAGCATGCCTTCTTGCAGTGTATGCTATAGCTACTAAGAAGGCATACAGGCACGTACTTCAACTATCCATTTGTTTGGGGCAGCTCTATG
GCACGGCTATATACTTCATAACAGCTGTCTTGGAAGGCGACAATTTTTCTACAAGCCCCTTCTATTACTACGCTTACTATGTCTTTGCAA
ATCATTTCTGGGTTTGGATACCAAGTCTCATAGTGATCCACTGCTGGAAGAAAATATGTGCTGCTGTCAACGTCCACGAGCAGAAGACCA
AGACCCGCTGA\(3')GGTGATTCTAAACATTGATATCCAAAAGCCTCAACTGAATAACATTGTCACGATTCTATTTCTTTGTATGGTTG
TTGAGTTTAATTGTCTTCATTAGAAACAATGCTGGAATGGAATATTATCTCTGTTCTAGAAATCTGCTCATTCCTGCTGAAATATGTCAT
TCTATATCTATGTTCTCCGTCTATATTTCTTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan