ESTScan Details for Unigene SGN-U244567

Score 
1919
Direction 
Forward
Predicted Peptide Sequence 
MATPISIQLNPSILSFPSNSTKAQFFQPNDKFLLKQKSNSSSRQFSSSFLQQQLPLHQLASARLVAVAAAAASGVVETVEDKLPADLHVT
ETQEPNSRIRLSVEVPTVVCEDCYKKVIKEFMRRSKVPGFRPGKNVPEDILVGFVGKQNIQNAVVEAILKRTLPHAMSSVTRNAYEDSIR
IVTKFEDMEKTYLSLNCLRYDVVVDVAPEIKWKPDDAYKNIKVVVELDSDIDAQRASEKELIRRHKSLGALRIVTDRGLQVGDVAVIDIS
ATTIEQDGSDAKTIPAAESKGFNFDTEDGDNVLPGFRDSIIGIKRGETKSFPLVFPDSWKQEDLRGVHAQFTVACKELFYRDLPELNDSI
AEKLLPGCSSIEEVKQALLQRCLEVEQAAKDQATDNAILDQLYKMVEVDIPQSLFQEQGRQLYGAQLLQLQANMKLNEQQLASLSSPRAV
NEFLETQKENIISIIKQNLAVGDIFTRENLQFSTEELVKEVQNSIQEFQQHQQEYDEDRVKLQVQEVLEGAKVLEWLRENAEIQYITGEK
TEMFNVPDKFQLXVDASENSVNVGVPKLLKEXSATDVINAPSKFQQYQFSRTYIAASYWLELKELCKILSIFFDLQMQFPG
Predicted Coding Sequence 
ATGGCGACTCCAATTTCCATCCAATTGAATCCTTCAATTCTCTCATTTCCATCAAATTCTACAAAAGCTCAATTCTTTCAACCCAATGAT
AAATTCTTGCTTAAACAAAAATCCAATTCATCTTCCCGCCAATTCTCCTCCTCCTTTCTTCAACAACAGCTCCCACTGCACCAGCTGGCT
TCAGCTCGATTGGTGGCGGTAGCGGCAGCAGCAGCTTCTGGTGTTGTTGAAACTGTTGAAGATAAACTTCCAGCTGATCTTCATGTTACT
GAAACACAGGAACCCAATTCAAGGATCAGATTGAGTGTTGAAGTTCCAACTGTTGTATGTGAGGATTGCTACAAAAAAGTCATAAAAGAG
TTCATGAGACGTTCAAAGGTTCCTGGATTTCGTCCAGGGAAGAATGTTCCAGAAGATATCCTTGTTGGCTTTGTCGGGAAGCAAAATATT
CAAAACGCTGTAGTTGAAGCTATTCTGAAAAGAACACTTCCACATGCCATGTCTTCGGTTACCCGGAACGCATATGAAGACTCCATCCGC
ATTGTGACCAAATTTGAAGACATGGAAAAAACTTATCTGTCTCTGAATTGCTTGAGGTATGATGTGGTTGTTGATGTGGCTCCTGAAATC
AAGTGGAAACCTGACGATGCATACAAGAATATTAAGGTGGTTGTTGAGCTTGACAGCGATATTGATGCTCAAAGAGCTTCAGAAAAAGAG
TTGATACGGCGTCACAAGTCTCTGGGTGCATTGAGAATTGTTACTGATAGGGGTTTACAGGTTGGCGATGTCGCAGTGATTGATATATCA
GCAACTACTATTGAGCAAGATGGATCAGACGCTAAAACCATACCAGCTGCAGAGAGTAAAGGTTTCAATTTTGATACAGAAGATGGAGAT
AATGTCCTTCCCGGATTTCGTGACTCAATTATTGGTATTAAACGAGGTGAAACGAAGTCATTCCCTTTGGTATTTCCAGACTCATGGAAA
CAAGAAGATCTTCGTGGTGTTCATGCTCAATTCACTGTTGCATGTAAGGAACTGTTCTACAGAGATTTGCCTGAGTTGAATGACTCGATT
GCAGAAAAGCTTCTCCCAGGATGCAGCTCCATTGAGGAGGTCAAGCAAGCGTTGCTACAAAGATGTCTTGAAGTTGAACAGGCAGCTAAA
GACCAAGCAACTGATAATGCCATCCTTGACCAGCTATACAAGATGGTTGAAGTTGATATTCCTCAATCTCTTTTCCAAGAGCAAGGAAGA
CAACTCTATGGAGCTCAACTTTTACAATTGCAGGCAAATATGAAACTGAACGAACAGCAGCTGGCATCGTTATCAAGCCCAAGGGCCGTG
AATGAGTTCCTTGAGACACAAAAAGAAAATATAATAAGTATCATAAAACAAAATTTAGCTGTTGGTGACATATTTACACGTGAAAATTTG
CAGTTTTCAACTGAGGAGCTAGTGAAGGAGGTTCAGAACTCAATTCAAGAATTCCAACAGCATCAACAGGAGTACGATGAGGACCGAGTT
AAGCTACAGGTACAAGAGGTACTTGAAGGGGCTAAAGTACTTGAATGGCTAAGGGAAAATGCAGAGATTCAGTACATAACTGGTGAAAAG
ACAGAAATGTTCAATGTTCCTGATAAGTTTCAACTTXATGTTGATGCTTCTGAGAACTCCGTCAACGTTGGTGTTCCCAAATTACTCAAA
GAAXTTTCAGCAACTGATGTGATAAATGCTCCAAGCAAGTTTCAGCAGTATCAATTTTCCAGAACTTATATTGCTGCAAGTTATTGGCTC
GAGCTGAAGGAGCTCTGCAAAATCTTGAGCATCTTTTTTGATCTTCAAATGCAATTTCCAGGATGA\
Edits in Original Sequence 
CACAAAGGGGAGTAGTGTTATCTTCATCACTTCTGCATTTCTGCTTAGAACTGAAAAAGAAA(5')ATGGCGACTCCAATTTCCATCCAA
TTGAATCCTTCAATTCTCTCATTTCCATCAAATTCTACAAAAGCTCAATTCTTTCAACCCAATGATAAATTCTTGCTTAAACAAAAATCC
AATTCATCTTCCCGCCAATTCTCCTCCTCCTTTCTTCAACAACAGCTCCCACTGCACCAGCTGGCTTCAGCTCGATTGGTGGCGGTAGCG
GCAGCAGCAGCTTCTGGTGTTGTTGAAACTGTTGAAGATAAACTTCCAGCTGATCTTCATGTTACTGAAACACAGGAACCCAATTCAAGG
ATCAGATTGAGTGTTGAAGTTCCAACTGTTGTATGTGAGGATTGCTACAAAAAAGTCATAAAAGAGTTCATGAGACGTTCAAAGGTTCCT
GGATTTCGTCCAGGGAAGAATGTTCCAGAAGATATCCTTGTTGGCTTTGTCGGGAAGCAAAATATTCAAAACGCTGTAGTTGAAGCTATT
CTGAAAAGAACACTTCCACATGCCATGTCTTCGGTTACCCGGAACGCATATGAAGACTCCATCCGCATTGTGACCAAATTTGAAGACATG
GAAAAAACTTATCTGTCTCTGAATTGCTTGAGGTATGATGTGGTTGTTGATGTGGCTCCTGAAATCAAGTGGAAACCTGACGATGCATAC
AAGAATATTAAGGTGGTTGTTGAGCTTGACAGCGATATTGATGCTCAAAGAGCTTCAGAAAAAGAGTTGATACGGCGTCACAAGTCTCTG
GGTGCATTGAGAATTGTTACTGATAGGGGTTTACAGGTTGGCGATGTCGCAGTGATTGATATATCAGCAACTACTATTGAGCAAGATGGA
TCAGACGCTAAAACCATACCAGCTGCAGAGAGTAAAGGTTTCAATTTTGATACAGAAGATGGAGATAATGTCCTTCCCGGATTTCGTGAC
TCAATTATTGGTATTAAACGAGGTGAAACGAAGTCATTCCCTTTGGTATTTCCAGACTCATGGAAACAAGAAGATCTTCGTGGTGTTCAT
GCTCAATTCACTGTTGCATGTAAGGAACTGTTCTACAGAGATTTGCCTGAGTTGAATGACTCGATTGCAGAAAAGCTTCTCCCAGGATGC
AGCTCCATTGAGGAGGTCAAGCAAGCGTTGCTACAAAGATGTCTTGAAGTTGAACAGGCAGCTAAAGACCAAGCAACTGATAATGCCATC
CTTGACCAGCTATACAAGATGGTTGAAGTTGATATTCCTCAATCTCTTTTCCAAGAGCAAGGAAGACAACTCTATGGAGCTCAACTTTTA
CAATTGCAGGCAAATATGAAACTGAACGAACAGCAGCTGGCATCGTTATCAAGCCCAAGGGCCGTGAATGAGTTCCTTGAGACACAAAAA
GAAAATATAATAAGTATCATAAAACAAAATTTAGCTGTTGGTGACATATTTACACGTGAAAATTTGCAGTTTTCAACTGAGGAGCTAGTG
AAGGAGGTTCAGAACTCAATTCAAGAATTCCAACAGCATCAACAGGAGTACGATGAGGACCGAGTTAAGCTACAGGTACAAGAGGTACTT
GAAGGGGCTAAAGTACTTGAATGGCTAAGGGAAAATGCAGAGATTCAGTACATAACTaGGTGAAAAGACAGAAATGTTCAATGTTCaCTG
ATAAGTTTCAACTTXATGTTGATGCTTCTGAGAACTCCGTCAACGTTGGTGTTCCCAAATTACTCAAAGAAXTTTCAGCAACTGATGTGA
TAAATGCTCCAAGCAAGTTTCAGCAGTATCAATTTTCCAGAACTTATATTGCTGCAAGTTATTGGCTCGAGCTGAAGGAGCTCTGCAAAA
TCTTGAGCATCTTTTTTGATCTTCAAATGCAATTTCCAGGATGA\(3')TGAATCGCCGCCTTGGTAAAGTTGAACTGAAACTACACTTA
TTTTGAGAGGCACTCAAGAACTGTTTATTTGTATACACTTTAACCAATTCATTTTTAATTCAAACCTTCTGTTACCTAGTCTCAGTGTGT
TTGTGCTTGCCTAGATTATGAGATTAAGCAATTTATTCCTTCTTTTTTGGTTAATAAAATCATTTTAATTTTATCAAAAAAAAAAAAAAA
AGAGTGANCTAGTCTCGAGGGGGGGCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan