ESTScan Details for Unigene SGN-U244739

Score 
720
Direction 
Forward
Predicted Peptide Sequence 
MPGIRGPSDYLREPPRHPCLKINAKEPFNAEPTRSALISSYVTPVDFFYKRNHGPIPVVDDIERYSVSLSGLIKNSKDLFMKDICKLPKY
TVTATLQCAGNRRTAMSKSRTVKGVGWDIAALGNAVWGGAKLADVLELVGIPYLTSITQSGGKHVEFVSIDKCKEENGGPYKASIPLSQA
TNPEADVLLAYEMNGEPLNRDHGYPLRVVVPGVIGARSVKWLDYINIIAEECQGFFMQKDYKMFPPTVNWDNINWSTXRPQMDFPVQRQY
X
Predicted Coding Sequence 
ATGCCTGGGATTAGAGGGCCTTCCGATTATTTGCGAGAACCCCCTCGCCATCCTTGCCTTAAAATTAACGCCAAGGAACCTTTTAATGCC
GAGCCAACTCGTTCAGCTCTGATTTCATCTTATGTCACTCCTGTTGATTTCTTCTACAAGAGAAACCACGGACCCATACCAGTAGTGGAT
GACATAGAGAGGTATTCCGTTTCTCTGAGTGGTCTTATTAAAAATTCCAAAGACTTGTTTATGAAGGATATTTGTAAGCTTCCAAAATAT
ACCGTTACTGCCACTTTACAGTGTGCTGGTAACAGAAGAACTGCTATGAGCAAGAGTCGAACGGTGAAAGGAGTTGGTTGGGATATTGCT
GCTTTAGGAAATGCTGTTTGGGGTGGAGCAAAATTGGCAGATGTTCTTGAATTAGTTGGAATACCTTATTTGACAAGTATCACACAATCT
GGAGGAAAACATGTTGAATTCGTGAGCATTGACAAGTGTAAGGAGGAAAATGGAGGTCCTTATAAGGCATCAATTCCATTGAGTCAGGCT
ACAAACCCTGAAGCTGATGTTCTGCTCGCTTATGAGATGAATGGAGAGCCACTTAATAGGGATCATGGCTATCCACTGCGTGTGGTTGTC
CCTGGTGTGATAGGTGCCCGTTCAGTTAAGTGGCTTGATTACATCAATATCATTGCCGAAGAATGCCAGGGATTCTTTATGCAAAAAGAC
TACAAGATGTTTCCACCAACAGTGAACTGGGATAACATCAACTGGTCTACTANGAGACCGCAGATGGACTTCCCTGTTCAGAGGCAATAT
GXX\
Edits in Original Sequence 
CACGAGGATTTGTACAAATCTCCTCATCTCTCTCACAACTCACACACATAGCAGGACTACAGTGAAGCCGGCGGCAAAGAAAACTGAGGA
AGTGAGAA
(5')ATGCCTGGGATTAGAGGGCCTTCCGATTATTTGCGAGAACCCCCTCGCCATCCTTGCCTTAAAATTAACGCCAAGGAA
CCTTTTAATGCCGAGCCAACTCGTTCAGCTCTGATTTCATCTTATGTCACTCCTGTTGATTTCTTCTACAAGAGAAACCACGGACCCATA
CCAGTAGTGGATGACATAGAGAGGTATTCCGTTTCTCTGAGTGGTCTTATTAAAAATTCCAAAGACTTGTTTATGAAGGATATTTGTAAG
CTTCCAAAATATACCGTTACTGCCACTTTACAGTGTGCTGGTAACAGAAGAACTGCTATGAGCAAGAGTCGAACGGTGAAAGGAGTTGGT
TGGGATATTGCTGCTTTAGGAAATGCTGTTTGGGGTGGAGCAAAATTGGCAGATGTTCTTGAATTAGTTGGAATACCTTATTTGACAAGT
ATCACACAATCTGGAGGAAAACATGTTGAATTCGTGAGCATTGACAAGTGTAAGGAGGAAAATGGAGGTCCTTATAAGGCATCAATTCCA
TTGAGTCAGGCTACAAACCCTGAAGCTGATGTTCTGCTCGCTTATGAGATGAATGGAGAGCCACTTAATAGGGATCATGGCTATCCACTG
CGTGTGGTTGTCCCTGGTGTGATAGGTGCCCGTTCAGTTAAGTGGCTTGATTACATCAATATCATTGCCGAAGAATGCCAGGGATTCTTT
ATGCAAAAAGACTACAAGATGTTTCCACCAACAGTGAACTGGGATAACATCAACTGGTCTACTANGAGACCGCAGATGGACTTCCCTGTT
CAGAGcGCAATATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan