ESTScan Details for Unigene SGN-U244757

Score 
771
Direction 
Forward
Predicted Peptide Sequence 
MSSSKFEPNDDIFDFVIKKANGIKGLVDTNLEIIPNQCIQPKEQRLDKSQIDNQESIPIIDLSNFDDLNVEKSIQEAASKWGFFQIINHG
IPTEVLEDLKDAAHKFFELPAEEKVKYRKEKLSPGESVFMFWSAIGEKDEKVLEWRDGIKHGCNPQNDSNLWPPQTRNQVLEYQKWAKPL
AKKLLEVLLKGLNVNEIDESLEPLFMGTMSININYYPPCPNPNIAMGFRRXLRHGLHNFAPPGRHXEAYISEGLKETGFTVNPIKGALTV
NIGDSLQIMSNDRYKSIEHWCKQFDSEQDSNIPVPVKVNPNLISVIGSSHKX
Predicted Coding Sequence 
ATGTCTTCTTCAAAATTTGAACCAAATGATGACATATTTGATTTTGTAATCAAGAAAGCAAATGGAATAAAAGGCCTAGTAGACACAAAC
CTTGAAATTATCCCAAATCAATGCATTCAACCAAAAGAACAAAGACTAGACAAGTCCCAAATTGATAATCAAGAATCAATCCCAATAATT
GATTTATCAAATTTTGATGATTTAAATGTTGAAAAGTCAATTCAAGAAGCAGCAAGCAAGTGGGGTTTCTTCCAAATCATCAATCATGGG
ATCCCAACTGAAGTTCTTGAAGATTTGAAGGATGCGGCACACAAATTCTTTGAATTGCCAGCTGAAGAAAAAGTTAAGTATCGTAAAGAA
AAACTTAGTCCGGGTGAATCTGTGTTTATGTTTTGGAGTGCTATTGGTGAGAAAGATGAGAAAGTTTTGGAGTGGAGGGATGGTATAAAA
CATGGTTGTAATCCACAAAATGATAGCAATCTTTGGCCTCCTCAAACAAGGAACCAAGTTTTGGAGTATCAAAAGTGGGCTAAACCACTT
GCTAAAAAATTGCTTGAGGTGCTATTGAAGGGTCTCAATGTCAATGAAATTGACGAATCTTTAGAACCTCTCTTTATGGGAACTATGTCT
ATAAACATCAACTACTATCCACCATGCCCAAATCCAAATATCGCCATGGGTTTTCGTAGAXCACTGCGACATGGGCTGCATAATTTTGCT
CCTCCAGGACGACACGXGGAGGCCTATATATCCGAGGGACTAAAGGAAACTGGATTCACXGTAAATCCTATCAAAGGTGCCTTAACAGTT
AATATAGGTGACTCATTGCAGATCATGAGCAATGATCGATACAAGAGTATCGAGCATTGGTGTAAGCAGTTTGATTCXGAGCAGGACTCG
AATATTCCTGTACCGGTAAAAGTGAATCCTAATTTGATCAGTGTCATCGGTTCATCCCACAAATGX\
Edits in Original Sequence 
AATATCTCAAATTTCCTTCTTCCATTTGTACACACTCGTCAAGATTCAATACAA(5')ATGTCTTCTTCAAAATTTGAACCAAATGATGA
CATATTTGATTTTGTAATCAAGAAAGCAAATGGAATAAAAGGCCTAGTAGACACAAACCTTGAAATTATCCCAAATCAATGCATTCAACC
AAAAGAACAAAGACTAGACAAGTCCCAAATTGATAATCAAGAATCAATCCCAATAATTGATTTATCAAATTTTGATGATTTAAATGTTGA
AAAGTCAATTCAAGAAGCAGCAAGCAAGTGGGGTTTCTTCCAAATCATCAATCATGGGATCCCAACTGAAGTTCTTGAAGATTTGAAGGA
TGCGGCACACAAATTCTTTGAATTGCCAGCTGAAGAAAAAGTTAAGTATCGTAAAGAAAAACTTAGTCCGGGTGAATCTGTGTTTATGTT
TTGGAGTGCTATTGGTGAGAAAGATGAGAAAGTTTTGGAGTGGAGGGATGGTATAAAACATGGTTGTAATCCACAAAATGATAGCAATCT
TTGGCCTCCTCAAACAAGGAACCAAGTTTTGGAGTATCAAAAGTGGGCTAAACCACTTGCTAAAAAATTGCTTGAGGTGCTATTGAAGGG
TCTCAATGTCAATGAAATTGACGAATCTTTAGAACCTCTCTTTATGGGAACTATGTCTATAAACATCAACTACTATCCACCATGCCCAAA
TCCAAATATCGCCATGGGTTTTCGTAGAXCACTGCGACATGGGCTGCATAATTTTGCTCCTCCAGGACGACACGXGGAGGCCTATATATC
CGAGGGACTAAAGGAAACTGGATTCACXGTAAATCCTATCAAAGGTGCCTTAACAGTTAATATAGGTGACTCATTGCAGATCATGAGCAA
TGATCGATACAAGAGTATCGAGCATTGGTGTAAGCAGTTTGATTCXGAGCAGGACTCGAATATTCCTGTACCGGTAAtAAGTGAATCCTA
ATTTGATCAGTGTCATCGGTTCATCCCACAAATGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan