ESTScan Details for Unigene SGN-U244758

Score 
221
Direction 
Forward
Predicted Peptide Sequence 
LNVNEIDESLEPLLMGTMSININYYPPCPNPSIAIGFRRXLRHGLHNFAPPGRXWEAYISEGLKATGFTVNPIKGALAVNIGDSLQIMSN
DRYKSIEHCVAVDSSRARISVPLLVNPSFDSVIGSFPQMLKDGEKPVYKHILFSDYWDHCFIKRPSGKASLDFAKI
Predicted Coding Sequence 
XXTCTCAATGTCAATGAAATTGACGAATCTTTAGAACCTCTCTTGATGGGAACTATGTCTATAAACATCAACTACTATCCACCATGCCCA
AATCCAAGTATCGCCATTGGTTTTCGTAGAXCACTGCGACATGGGCTGCATAACTTTGCTCCTCCAGGACGAXCATGGGAGGCCTATATA
TCCGAGGGACTAAAGGCAACTGGATTCACXGTAAATCCTATCAAAGGTGCCTTAGCGGTTAATATAGGTGACTCACTGCAGATCATGAGC
AATGATCGATACAAGAGTATCGAGCATTGTGTAGCAGTTGATTCGAGCAGGGCTCGAATATCTGTACCGCTATTAGTGAATCCTAGTTTT
GATAGTGTCATTGGTTCATTCCCACAAATGCTAAAAGATGGAGAAAAACCAGTGTACAAACATATTTTGTTCTCTGATTATTGGGATCAT
TGCTTCATTAAGAGGCCTTCTGGTAAAGCATCACTAGATTTTGCTAAAATTTGA\
Edits in Original Sequence 
(5')XXTCTCAATGTCAATGAAATTGACGAATCTTTAGAACCTCTCTTGATGGGAACTATGTCTATAAACATCAACTACTATCCACCATG
CCCAAATCCAAGTATCGCCATTGGTTTTCGTAGAXCACTGCGACATGGGCTGCATAACTTTGCTCCTCCAGGACGAXCATGGGAGGCCTA
TATATCCGAGGGACTAAAGGCAACTGGATTCACXGTAAATCCTATCAAAGGTGCCTTAGCGGTTAATATAGGTGACTCACTGCAGATCAT
GAGCAATGATCGATACAAGAGTATCGAGCATTGTGTAGCAGTTGATTCGAGCAGGGCTCGAATATCTGTACCGCTATTAGTGAATCCTAG
TTTTGATAGTGTCATTGGTTCATTCCCACAAATGCTAAAAGATGGAGAAAAACCAGTGTACAAACATATTTTGTTCTCTGATTATTGGGA
TCATTGCTTCATTAAGAGGCCTTCTGGTAAAGCATCACTAGATTTTGCTAAAATTTGA\(3')TGCTTTAATTTTCAAATTTCTTGTATG
TTAATGTTTTTGTATTATAAATCTGTTATTGTAGTGACGAAAGCTGTTATTTTATGTAACTTGCAATTTGGTGCGATCTTGTCCGTTATT
TATTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan