ESTScan Details for Unigene SGN-U244775

Score 
761
Direction 
Forward
Predicted Peptide Sequence 
MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHV
LLAVRNDEELGKLLAGVTIASGGVLPNINPILLPKKSAVADEKAPKSKAAKSPKKA
Predicted Coding Sequence 
ATGGATGCTACTAAGACAACTAAAGGTGCCGGAGGAAGAAAGGGTGGCCCAAGGAAGAAGTCCGTCACCAAGTCAATCAAAGCTGGTCTT
CAGTTTCCAGTCGGTCGTATTGGTCGTTACTTGAAGAAGGGTCGATATGCTCAGCGTGTAGGATCTGGTGCTCCAATTTATCTCGCTGCT
GTTCTGGAATACCTTGCTGCTGAGGTGTTGGAGTTGGCTGGAAATGCGGCCAGAGACAACAAGAAGAGCAGAATCATTCCTAGGCATGTG
CTTTTGGCAGTGAGGAATGATGAAGAGTTGGGAAAATTGTTGGCTGGAGTTACAATTGCAAGTGGAGGTGTTCTTCCTAACATTAACCCA
ATTCTGTTGCCTAAGAAATCCGCAGTTGCCGATGAGAAGGCACCTAAATCCAAAGCAGCAAAGTCTCCAAAGAAGGCATAA\
Edits in Original Sequence 
TGGATCCCCCGGGCTGCAGGTTTCATCAAAGCACTCAAGCTTTCTTCTGTATTACTCTCTTTAAGCTTTTCTTCACACAGCA(5')ATGG
ATGCTACTAAGACAACTAAAGGTGCCGGAGGAAGAAAGGGTGGCCCAAGGAAGAAGTCCGTCACCAAGTCAATCAAAGCTGGTCTTCAGT
TTCCAGTCGGTCGTATTGGTCGTTACTTGAAGAAGGGTCGATATGCTCAGCGTGTAGGATCTGGTGCTCCAATTTATCTCGCTGCTGTTC
TGGAATACCTTGCTGCTGAGGTGTTGGAGTTGGCTGGAAATGCGGCCAGAGACAACAAGAAGAGCAGAATCATTCCTAGGCATGTGCTTT
TGGCAGTGAGGAATGATGAAGAGTTGGGAAAATTGTTGGCTGGAGTTACAATTGCAAGTGGAGGTGTTCTTCCTAACATTAACCCAATTC
TGTTGCCTAAGAAATCCGCAGTTGCCGATGAGAAGGCACCTAAATCCAAAGCAGCAAAGTCTCCAAAGAAGGCATAA\(3')GACTCAAT
TAGAAGTTTCACCGTCGGGTTAAATATGCAGCAATCTTTTGTCTAGTTTATCGGTACTTCTAGTAGTAGGATGTAGATTTCTGTTATGGT
TTGATAACCTTGGTGTAACGTGCTTGGAAATATAATAGAAATTATCTCATTTTCTATAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan