Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U245078

Score 
687
Direction 
Forward
Predicted Peptide Sequence 
MVDNFDDIINWDDVDHIFHNVLDNPHDDDQFTLHDSSPQTFQQIEQLLMNDDDVGLVSFEDADPQFAADFLSDVLVDSPLHSDHSHSPAE
QAIGFTDSKVSSGSDADQDKHKSPSDGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKRLGFVLQCCLAEN
QALRFSLQNSSANGVSXDQAGVCRALVGIPAVGFPALVPGHHMPAHSTQPNLSVPEENQGSRNHGLLLPIKEGKKTSRILLFLSFMMGKR
CKASRSRMKFNPHSLGVVM
Predicted Coding Sequence 
ATGGTCGATAACTTCGATGATATCATCAACTGGGACGATGTAGATCACATCTTCCACAACGTTCTAGACAATCCCCACGATGATGATCAA
TTCACTCTTCATGATTCCTCCCCACAGACATTCCAGCAGATCGAGCAGCTTCTTATGAACGATGACGATGTCGGTCTTGTCTCTTTTGAA
GACGCTGATCCTCAATTTGCTGCCGACTTTCTCTCCGACGTCCTCGTCGATTCCCCTCTTCACTCCGATCATTCTCACTCTCCTGCTGAA
CAAGCCATTGGATTCACCGATTCCAAGGTTTCTAGTGGATCCGACGCCGATCAGGACAAACACAAGTCGCCTTCTGACGGGGACGACGAA
TTAAACAACCATGACCCTGTCGATAAGAAGCGCAAGAGGCAATTGAGGAACAGAGATGCAGCTGTGAGGTCACGAGAGAGGAAGAAGTTG
TACGTTAGGGATCTTGAGTTGAAGAGTAGATACTTTGAATCAGAATGCAAAAGGCTGGGGTTTGTTCTCCAGTGCTGTCTTGCTGAAAAT
CAAGCTTTACGCTTCTCTTTGCAGAATAGCAGTGCTAATGGTGTTTCTXATGACCAAGCAGGAGTCTGCCGTGCTCTTGTTGGAATCCCT
GCTGTTGGGTTCCCTGCTTTGGTTCCTGGGCATCACATGCCTGCTCATTCTACCCAGCCAAACCTGTCAGTTCCAGAAGAAAATCAGGGA
AGCAGAAACCACGGGCTTCTCCTTCCAATAAAGGAAGGAAAAAAGACTAGTCGGATTTTGTTGTTCCTGTCCTTCATGATGGGCAAAAGA
TGCAAAGCTTCAAGATCGAGGATGAAGTTCAACCCCCATTCCTTGGGAGTTGTGATGTGA\
Edits in Original Sequence 
CAGAGGTCGGGTCCCAAATAGTAAGTCGGGCCCTAGTTTCTTCACCCCCACAATCTCCGTCGAACTGGCG(5')ATGGTCGATAACTTCG
ATGATATCATCAACTGGGACGATGTAGATCACATCTTCCACAACGTTCTAGACAATCCCCACGATGATGATCAATTCACTCTTCATGATT
CCTCCCCACAGACATTCCAGCAGATCGAGCAGCTTCTTATGAACGATGACGATGTCGGTCTTGTCTCTTTTGAAGACGCTGATCCTCAAT
TTGCTGCCGACTTTCTCTCCGACGTCCTCGTCGATTCCCCTCTTCACTCCGATCATTCTCACTCTCCTGCTGAACAAGCCATTGGATTCA
CCGATTCCAAGGTTTCTAGTGGATCCGACGCCGATCAGGACAAACACAAGTCGCCTTCTGACGGGGACGACGAATTAAACAACCATGACC
CTGTCGATAAGAAGCGCAAGAGGCAATTGAGGAACAGAGATGCAGCTGTGAGGTCACGAGAGAGGAAGAAGTTGTACGTTAGGGATCTTG
AGTTGAAGAGTAGATACTTTGAATCAGAATGCAAAAGGCTGGGGTTTGTTCTCCAGTGCTGTCTTGCTGAAAATCAAGCTTTACGCTTCT
CTTTGCAGAATAGCAGTGCTAATGGTGTTTCTXATGACCAAGCAGGAGTCTGCCGTGCTCTTGTTGGAATCCCTGCTGTTGGGTTCCCTG
CTTTGGTTCCTGGGCATCACATGCCTGCTCATTCTACCCAGCCAAACCTgGTCAGTTCCAGAAGAAAATCAGGGAAGCAGAAACCACGGG
CTTCTCCTTCCAATAAAGGAAGGAAAAAAGACTAGTCGGATTTTGTTGTTCCTGTCCTTCATGATGGGCAAAAGATGCAAAGCTTCAAGA
TCGAGGATGAAGTTCAACCCCCATTCCTTGGGAGTTGTGATGTGA\(3')TTCGTTGTGATCAAATCCATTCCCTTAGGTGGATCATGGT
TCCTTTTGAGTTCTTTAGTTTTGTGTCAGAGATTCTCTGTATGTGTCTTGCTTTGACATCTGAAGGATGTAGTTCACTGTTATTAGTTAA
TGACTTATGAGCTATATATATTATCTATGCAACTTTTTAACAGTTCCAACCGGAAAAAAAAAAAAAAAAGAGAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan