ESTScan Details for Unigene SGN-U245087

Score 
507
Direction 
Forward
Predicted Peptide Sequence 
MAKLVSFFVLALIAISMVATTALAADAQYHLDRSRYGPGSLKPTQCLPQCTRRCSKTQYHKPCMFFCQKCCKTCLCVPPGFYGNKGVCPC
YNNWKTKEGGPKCP
Predicted Coding Sequence 
ATGGCGAAGCTTGTTTCATTTTTCGTTTTGGCCCTTATTGCCATTTCCATGGTTGCAACCACTGCTCTAGCTGCTGATGCCCAGTACCAC
CTTGATCGTTCAAGGTATGGTCCAGGGAGCTTGAAGCCAACACAATGCCTGCCACAATGTACAAGAAGATGTAGCAAGACACAGTACCAC
AAGCCATGCATGTTCTTTTGCCAGAAATGCTGTAAGACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCATGC
TACAACAACTGGAAGACCAAAGAAGGAGGACCAAAATGCCCTTAA\
Edits in Original Sequence 
CACAAAGAAAGCCTCTCTTTTCTTTTGCTTTCTGTGAAGCAAAATCAGCA(5')ATGGCGAAGCTTGTTTCATTTTTCGTTTTGGCCCTT
ATTGCCATTTCCATGGTTGCAACCACTGCTCTAGCTGCTGATGCCCAGTACCACCTTGATCGTTCAAGGTATGGTCCAGGGAGCTTGAAG
CCAACACAATGCCTGCCACAATGTACAAGAAGATGTAGCAAGACACAGTACCACAAGCCATGCATGTTCTTTTGCCAGAAATGCTGTAAG
ACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCATGCTACAACAACTGGAAGACCAAAGAAGGAGGACCAAAA
TGCCCTTAA\(3')TTAATTAACCACATTGCTACTCTAAATTTGTCACCCCAAAGTTTAATTGATATTGTTGTTTATTGGTCTTCTTGAT
CCTATTATTATTTTGTCTGAATTAAGAGGTCATTAGTTGTATGACCTTTTTTACTTTTGTGTATGTATTTGCTCCTTTGGGCAGTATTGC
CCGATATGAGAGCTGTTTGACCAATTTTTCTGTTGGTCTATTGTTATGTTACTCTTTTCTAATATAACAAAATCTTGTCCAAAAAAAAAA
AAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan