ESTScan Details for Unigene SGN-U245186

Score 
401
Direction 
Forward
Predicted Peptide Sequence 
RRRLRLRRPQLPNHRQPNKKITQNSDRRRQRRWTATAGLYLHPIDPPIKASSAQLEEIKSRXLEASGKLSNLRPFGYHLSIISSDERSAY
SFRCIFKCAVVSSSISPVNVPLFSALLACAIAQFLKLFTTWYKEKRWDSKRMLSSGGMPSSHSATVTSLIMAIYLQEGAGGSVFAIAVVL
ACVVMYDATGVRLHAGRQAELLNQIVCELPPEHPVANVRPLRDSLGHTPLQVLAGAXAGICSAISAEKLNLSSTLSSPFKYSVNIDKVPA
IKAGINITTKGESMRIHPFFTLLV
Predicted Coding Sequence 
CGTCGACGCCTTCGCCTTCGCCGTCCACAATTACCAAATCACAGGCAACCTAACAAAAAAATCACACAAAACTCCGATCGACGACGACAA
CGCCGGTGGACGGCGACGGCGGGGCTTTACCTTCATCCTATAGATCCACCAATCAAAGCCTCCTCGGCGCAATTGGAAGAAATCAAGTCT
AGAXTTCTAGAAGCTTCCGGTAAATTATCAAATCTCCGTCCGTTTGGTTATCATCTCTCAATTATCTCATCAGATGAACGAAGTGCTTAC
AGCTTCCGATGCATCTTCAAGTGCGCGGTCGTATCGTCGTCGATTTCACCTGTCAATGTTCCCCTCTTTTCTGCTTTACTTGCCTGTGCT
ATTGCACAATTCCTCAAGCTGTTCACCACCTGGTACAAGGAGAAGAGATGGGATTCAAAAAGGATGCTTAGCTCAGGTGGAATGCCATCA
TCACATTCAGCAACAGTTACTTCACTGATAATGGCAATTTATTTACAGGAAGGAGCTGGAGGATCTGTCTTCGCGATTGCTGTGGTTTTG
GCATGTGTTGTAATGTATGATGCTACCGGTGTTAGGCTTCATGCTGGGCGCCAAGCTGAATTGTTGAACCAGATAGTGTGTGAATTGCCT
CCCGAGCATCCTGTTGCCAATGTTAGACCTCTGCGAGATTCGCTTGGTCACACTCCCCTTCAGGTTCTTGCCGGTGCAGXTGCTGGGATC
TGTAGTGCCATTTCTGCTGAGAAGCTCAATCTGAGTTCAACTTTATCATCTCCCTTCAAATACTCAGTAAATATCGACAAGGTTCCAGCT
ATTAAAGCTGGAATCAACATCACTACCAAGGGAGAGTCCATGCGAATTCATCCTTTCTTCACCTTGTTGGTX\
Edits in Original Sequence 
(5')CGTCGACGCCTTCGCCTTCGCCGTCCACAATTACCAAATCACAGGCAACCTAACAAAAAAATCACACAAAACTCCGATCGACGACG
ACAACGCCGGTGGACGGCGACGGCGGGGCTTTACCTTCATCCTATAGATCCACCAATCAAAGCCTCCTCGGCGtCAATTGGAAGAAATCA
AGTCTAGAXTTCTAGAAGCTTCCGGTAAATTATCAAATCTCCGTCCGTTTGGTTATCtATCTCTCAATTATCTCATCAGATGAACGAAGT
GCTTACAGCTTCCGATGCATCTTCAAGTGCGCGGTCGTATgCGTCGTCGATTTCACCTGTCAATGTTCCCCTCTTTTCTGCTTTACTTGC
CTGTGCTATTGCACAATTCCTCAAGCTGTTCACCACCTGGTACAAGGAGAAGAGATGGGATTCAAAAAGGATGCTTAGCTCAGGTGGAAT
GCCATCATCACATTCAGCAACAGTTACTTCACTGATAATGGCAATTTATTTACAGGAAGGAGCTGGAGGATCTGTCTTCGCGATTGCTGT
GGTTTTGGCATGTGTTGTAATGTATGATGCTACCGGTGTTAGGCTTCATGCTGGGCGCCAAGCTGAATTGTTGAACCAGATAGTGTGTGA
ATTGCCTCCCGAGCATCCTGTTGCCAATGTTAGACCTCTGCGAGATTCGCTTGGTCACACTCCCCTTCAGGTTCTTGCCGGTGCAGXTGC
TGGGATCTGTAGTGCCATTTCTGCTGAGAAGCTCAATCTaGAGTTCAACTTTATCATCTCCCTTCAAATACTCAGTAAATATCGACAAGG
TTCCaAGCTATTAAAGCTGGAATCAACATCACTACCAAGGGAGAGTCCATGCGAATTCATCCTTTCTTCACCTTGTTGGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan