Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U245721

Score 
2645
Direction 
Forward
Predicted Peptide Sequence 
LESIFXEKKRINETSWTWKGKIKQLVKAEMVDKLIVAVEGTAALGPYWKTIASDYLDKIIRCFFGVDSTSQKSSAADVEVSLVMFNTHGS
YSACLVQRSGWTRDMDTFLQWLSAIPFLGGGFNDAAVAEGLAEALVMFSGLNGNQSQQNMEGKKHCILISGSNPYPLPTPVYRPQMQKLE
QNENIEAQTDSRLSDAETVAKAFPQCSISLSVLCPKKLPKLRAIYDAGKHNPRAADPPIDTAKNPNFLVLISENFIEARAAFSXLWNDQL
GSNHSPVKMDVSSVLPVSGTQSISNSAANVSVMSRPPISAGNIPPATVKIEPNTVTSMTGPAFSHIPSVRPALQPVPSLQASSPLSVSQE
MASHTENVQEMKPIVSGMTQSLRPVAAAAANVKILNGVAQAHQVLGGGTSIGLQSMGGTPMLSSMISSGMASSVPASQAVLSSGQSGVTT
MTGAVPLAGSAQNTQNSAPSSFTSTAPSMSGNSNISISQPLNNNQRGVSMTGQTVPGMSQGNLPGTQMMPSGTGMNQNMLTGLGATGLPS
GTGTMMPTPGMSQQGQPGMQPVGVNSTSANMPLSQQQTSAALPSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASESLAANWPPT
MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPSQQQQAAA
AAAASTTSTAAAATATAASYAATTAAPSTAAATATAATSHATAATTADSVATITDSPNAATTDSPNAAAAAADPANAAAAADSANAAATA
AARDEPNLHARSCKVTNNVSESSFITRTANHTRRRVYEXENVIELAAIVQTVRPGVDSKSVTMHLVHILQMKFEVFKFVVGSSIEITCAP
SNQVSVAXKGKIKGEEGGIFWVWA
Predicted Coding Sequence 
TTAGAGAGTATTTTTAANGAAAAGAAAAGAATAAACGAAACAAGTTGGACGTGGAAAGGGAAAATCAAGCAGTTGGTTAAAGCAGAGATG
GTGGACAAACTGATCGTCGCCGTTGAAGGCACCGCTGCGTTGGGTCCTTACTGGAAAACCATCGCTTCCGATTACCTTGATAAAATTATC
AGGTGCTTTTTTGGAGTGGACTCAACTTCACAGAAATCATCTGCAGCCGATGTGGAGGTCTCCTTGGTCATGTTTAATACACATGGTTCT
TATAGTGCTTGCCTGGTTCAGCGGAGTGGCTGGACAAGAGACATGGATACCTTTTTGCAGTGGCTTTCAGCTATACCTTTTTTAGGAGGT
GGTTTCAATGACGCTGCAGTTGCAGAAGGACTTGCTGAAGCATTAGTGATGTTTTCTGGACTAAATGGTAACCAAAGTCAACAAAACATG
GAAGGGAAAAAACATTGTATACTTATTTCTGGAAGCAACCCTTATCCGTTGCCTACACCAGTTTATCGACCACAGATGCAGAAACTGGAG
CAGAACGAAAATATTGAAGCACAAACAGATAGTCGACTATCGGATGCTGAGACAGTTGCAAAGGCATTCCCTCAGTGTTCCATTTCCCTG
TCAGTTCTATGCCCAAAAAAGCTTCCAAAACTAAGAGCAATATATGATGCGGGAAAACACAATCCACGAGCAGCTGACCCACCCATTGAT
ACGGCTAAGAATCCAAACTTTCTTGTTTTGATATCCGAAAACTTCATCGAGGCTCGTGCTGCTTTCAGTCXGCTCTGGAATGACCAACTT
GGCTCAAATCACAGCCCTGTCAAGATGGATGTGTCTTCTGTTCTTCCAGTTTCTGGCACACAATCAATTTCTAATTCAGCAGCAAATGTA
TCTGTTATGAGTCGACCACCAATTTCCGCTGGAAATATTCCTCCTGCCACTGTAAAAATTGAGCCCAACACTGTGACCTCCATGACTGGA
CCTGCATTTTCACATATTCCGTCTGTTCGTCCTGCTCTTCAACCGGTTCCAAGCTTGCAAGCTTCTTCTCCTCTTTCTGTTTCTCAGGAG
ATGGCATCACATACTGAGAATGTTCAGGAGATGAAACCCATAGTCAGTGGTATGACTCAGTCCTTACGTCCAGTTGCTGCTGCAGCAGCA
AATGTCAAAATCTTGAACGGTGTTGCTCAGGCACACCAAGTTCTAGGCGGGGGAACTTCTATAGGACTGCAATCTATGGGTGGCACCCCT
ATGCTTTCAAGTATGATATCTAGTGGAATGGCATCTTCCGTCCCTGCTTCTCAAGCTGTATTATCATCTGGGCAATCAGGTGTGACAACA
ATGACTGGGGCTGTTCCACTAGCAGGAAGTGCACAGAATACGCAAAACTCAGCTCCTTCTTCATTCACTTCAACTGCTCCCAGTATGTCT
GGGAATTCAAACATAAGCATTTCACAGCCTTTGAATAATAACCAAAGAGGTGTTAGTATGACTGGTCAAACAGTTCCTGGAATGAGCCAA
GGTAATCTACCAGGCACACAAATGATGCCAAGTGGGACAGGGATGAACCAGAATATGCTGACTGGGCTTGGTGCAACTGGTTTGCCTTCC
GGAACTGGCACAATGATGCCTACTCCAGGGATGTCTCAACAAGGACAACCAGGCATGCAACCAGTTGGTGTGAACAGCACATCAGCTAAC
ATGCCTCTATCTCAACAGCAAACATCTGCTGCATTGCCATCAGCTCAATCAAAATATGTCAAAGTTTGGGAGGGAAACTTATCTGGTCAG
AGACAGGGCCAACCTGTATTTATTACCAGATTAGAGGGGTATAGGAGCGCCTCAGCTTCTGAATCGCTTGCTGCAAATTGGCCTCCAACA
ATGCAAATTGTTCGCCTTATTTCCCAGGATCATATGAATAACAAACAATATGTTGGGAAGGCAGATTTTCTAGTTTTTCGGGCAATGAAC
CAGCATGGATTCCTTAGTCAGCTGCAAGAAAAGAAGCTTTGTGCAGTAATACAACTTCCATCGCAGACACTGCTTCTCTCTGTTTCTGAT
AAAGCCTGCCGCTTGATTGGAATGCTTTTTCCTGGGGATATGGTGGTGTTTAAGCCACAGATACCAAGTCAGCAGCAACAAGCAGCAGCA
GCAGCAGCTGCAAGCACAACATCCACAGCTGCAGCAGCAACAGCAACAGCAGCATCTTACGCAGCTACAACAGCAGCCCCTTCAACAGCT
GCAGCAACAGCAACAGCAGCAACCTCTCATGCAACTGCAGCAACAACAGCAGATTCCGTTGCAACAATCACAGATTCCCCAAATGCAGCA
ACAACAGATTCACCAAATGCAGCAGCAGCAGCAGCAGATCCCGCAAATGCAGCAGCAGCAGCAGATTCCGCAAATGCAGCAGCAACAGCA
GCAGCAAGGGATGAACCAAACCTACATGCAAGGTCCTGCAAGGTCACAAATAATGTCTCAGAGTCAAGTTTCATCACAAGGACTGCCAAC
CATACCAGGAGGCGGGTTTATGAAXTTGAAAATGTCATAGAACTAGCAGCCATTGTACAAACTGTGAGACCAGGCGTTGATTCCAAAAGT
GTAACCATGCATTTGGTGCATATCTTACAAATGAAATTCGAAGTATTCAAATTCGTTGTAGGCTCTAGCATAGAAATTACTTGTGCTCCT
TCGAATCAGGTTAGCGTGGCTGXTAAAGGCAAGATAAAAGGGGAAGAGGGAGGAATTTTCTGGGTGTGGGCTTGA\
Edits in Original Sequence 
(5')TTAGAGAGTATTTTTAANGAAAAGAAAAGAATAAACGAAACAAGTTGGACGTGGAAAGGGAAAATCAAGCAGTTGGTTAAAGCAGA
GATGGTGGACAAACTGATCGTCGCCGTTGAAGGCACCGCTGCGTTGGGTCCTTACTGGAAAACCATCGCTTCCGATTACCTTGATAAAAT
TATCAGGTGCTTTTTTGGAGTGGACTCAACTTCACAGAAATCATCTGCAGCCGATGTGGAGGTCTCCTTGGTCATGTTTAATACACATGG
TTCTTATAGTGCTTGCCTGGTTCAGCGGAGTGGCTGGACAAGAGACATGGATACCTTTTTGCAGTGGCTTTCAGCTATACCTTTTTTAGG
AGGTGGTTTCAATGACGCTGCAGTTGCAGAAGGACTTGCTGAAGCATTAGTGATGTTTTCTGGACTAAATGGTAACCAAAGTCAACAAAA
CATGGAAGGGAAAAAACATTGTATACTTATTTCTGGAAGCAACCCTTATCCGTTGCCTACACCAGTTTATCGACCACAGATGCAGAAACT
GGAGCAGAACGAAAATATTGAAGCACAAACAGATAGTCGACTATCGGATGCTGAGACAGTTGCAAAGGCATTCCCTCAGTGTTCCATTTC
CCTGTCAGTTCTATGCCCAAAAAAGCTTCCAAAACTAAGAGCAATATATGATGCGGGAAAACACAATCCACGAGCAGCTGACCCACCCAT
TGATACGGCTAAGAATCCAAACTTTCTTGTTTTGATATCCGAAAACTTCATCGAGGCTCGTGCTGCTTTCAGTCXGCTCTGGAATGACCA
ACTTGGCgTCAAATCACAGCCCTGTCAAGATGGATGTGTCTTCTGTTCTTCCAGTTTCTGGCACACAATCAATTTCTAATTCAGCAGCAA
ATGTATCTGTTATGAGTCGACCACCAATTTCCGCTGGAAATATTCCTCCTGCCACTGTAAAAATTGAGCCCAACACTGTGACCTCCATGA
CTGGACCTGCATTTTCACATATTCCGTCTGTTCGTCCTGCTCTTCAACCGGTTCCAAGCTTGCAAGCTTCTTCTCCTCTTTCTGTTTCTC
AGGAGATGGCATCACATACTGAGAATGTTCAGGAGATGAAACCCATAGTCAGTGGTATGACTCAGTCCTTACGTCCAGTTGCTGCTGCAG
CAGCAAATGTCAAAATCTTGAACGGTGTTGCTCAGGCACACCAAGTTCTAGGCGGGGGAACTTCTATAGGACTGCAATCTATGGGTGGCA
CCCCTATGCTTTCAAGTATGATATCTAGTGGAATGGCATCTTCCGTCCCTGCTTCTCAAGCTGTATTATCATCTGGGCAATCAGGTGTGA
CAACAATGACTGGGGCTGTTCCACTAGCAGGAAGTGCACAGAATACGCAAAACTCAGCTCCTTCTTCATTCACTTCAACTGCTCCCAGTA
TGTCTGGGAATTCAAACATAAGCATTTCACAGCCTTTGAATAATAACCAAAGAGGTGTTAGTATGACTGGTCAAACAGTTCCTGGAATGA
GCCAAGGTAATCTACCAGGCACACAAATGATGCCAAGTGGGACAGGGATGAACCAGAATATGCTGACTGGGCTTGGTGCAACTGGTTTGC
CTTCCGGAACTGGCACAATGATGCCTACTCCAGGGATGTCTCAACAAGGACAACCAGGCATGCAACCAGTTGGTGTGAACAGCACATCAG
CTAACATGCCTCTATCTCAACAGCAAACATCTGCTGCATTGCCATCAGCTCAATCAAAATATGTCAAAGTTTGGGAGGGAAACTTATCTG
GTCAGAGACAGGGCCAACCTGTATTTATTACCAGATTAGAGGGGTATAGGAGCGCCTCAGCTTCTGAATCGCTTGCTGCAAATTGGCCTC
CAACAATGCAAATTGTTCGCCTTATTTCCCAGGATCATATGAATAACAAACAATATGTTGGGAAGGCAGATTTTCTAGTTTTTCGGGCAA
TGAACCAGCATGGATTCCTTAGTCAGCTGCAAGAAAAGAAGCTTTGTGCAGTAATACAACTTCCATCGCAGACACTGCTTCTCTCTGTTT
CTGATAAAGCCTGCCGCTTGATTGGAATGCTTTTTCCTGGGGATATGGTGGTGTTTAAGCCACAGATACCAAGTCAGCAGCAACAAGCAG
CAGCAGCAGCAGCTGCAAGCACAACATCCACAGCTGCAGCAGCAACAGCAACAGCAGCATCTTACGCAGCTACAACAGCAGCCCCTTCAA
CAGCTGCAGCAACAGCAACAGCAGCAACCTCTCATGCAACTGCAGCAACAACAGCAGATTCCGTTGCAACAATCACAGATTCCCCAAATG
CAGCAACAACAGATTCACCAAATGCAGCAGCAGCAGCAGCAGATCCCGCAAATGCAGCAGCAGCAGCAGATTCCGCAAATGCAGCAGCAA
CAGCAGCAGCAAGGGATGAACCAAACCTACATGCAAGGTCCTGCAAGGTCACAAATAATGTCTCAGAGTCAAGTTTCATCACAAGGACTG
CCAACCATACCAGGAGGCGGGTTTATGAAXTTGAAAATGTCATAGAACTAGaCAGCCATTGTACAAACTGTGAGACCAGGCgGTTGATTC
CAAAAGTGTAACCATGCATTTGGTGCATATCTTACAAATGAAATTCGAAGTATTCAAATTCGTTGTAGGCTCTAGCATAGAAATTACTTG
TGCTCCTTCGAATCAGGTTAGCGTGGCTGXTAAAGGCAAGATAAAAGGGGAAGAGGGAGGAATTTTCTGGGTGTGGGCTTGA\(3')GAG
CATATGATTGCATATTTGATCACCAACCTATTTTCTATTGATCATAGTTCACCAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan