ESTScan Details for Unigene SGN-U245733

Score 
765
Direction 
Forward
Predicted Peptide Sequence 
MQEVRTVRVGNVSDLAAEREVREFFSFSGEIEHIEIRREQGQSKTAFVTFKDPKALEIALLLSGATIVDQIVNITQEEDYVPSSETREVR
LVDNAVNVAGESSSPLAEAKPTSPSNGRVNGKVYISKAQDVVSNVLAKGSAIRQDAMNKAKAFDEKHQLRATASARVISFDRRVGLTEKL
TVGISVVNEKVKSVDQRLQVSDKTMAAVMAAERKLNDTGSAVKSSRYVNAGAAWLNGAFSKVAKAGQVAGTKTREKWNFALSNLTAKDPS
IVA
Predicted Coding Sequence 
ATGCAGGAGGTAAGAACAGTACGAGTAGGTAATGTATCAGATCTGGCAGCTGAGAGAGAGGTTCGCGAGTTCTTCTCGTTTTCCGGCGAG
ATTGAGCATATTGAGATTCGCCGAGAACAAGGACAATCCAAGACTGCCTTTGTTACATTTAAAGATCCGAAAGCGCTTGAAATTGCTTTG
TTGTTGTCGGGAGCAACCATAGTGGATCAGATTGTAAATATTACTCAGGAAGAAGACTATGTTCCATCATCTGAGACTCGGGAAGTCAGG
TTAGTTGATAATGCCGTGAATGTTGCTGGAGAAAGTTCTTCTCCGCTTGCTGAGGCCAAACCTACTTCTCCTAGCAATGGAAGGGTGAAC
GGGAAAGTATATATCAGTAAAGCCCAAGATGTTGTCTCAAATGTGTTGGCAAAAGGTTCAGCTATCAGACAAGATGCAATGAATAAAGCC
AAGGCATTTGATGAGAAACATCAGCTAAGAGCCACTGCATCTGCCCGAGTCATTTCCTTTGACCGAAGAGTTGGGCTAACAGAAAAGCTT
ACGGTTGGAATTTCTGTTGTAAATGAGAAAGTTAAATCTGTTGATCAAAGGCTTCAAGTGTCAGACAAAACGATGGCTGCAGTTATGGCA
GCAGAACGGAAATTGAATGACACAGGATCAGCGGTCAAATCAAGCAGGTATGTTAATGCTGGAGCTGCCTGGCTGAATGGTGCTTTTAGT
AAAGTAGCCAAGGCAGGGCAAGTTGCTGGTACAAAAACGAGAGAGAAATGGAATTTTGCATTGTCAAATTTGACAGCAAAGGATCCTTCT
ATTGTTGCCTAG\
Edits in Original Sequence 
AGATTTTAAACTCAATA(5')ATGCAGGAGGTAAGAACAGTACGAGTAGGTAATGTATCAGATCTGGCAGCTGAGAGAGAGGTTCGCGAG
TTCTTCTCGTTTTCCGGCGAGATTGAGCATATTGAGATTCGCCGAGAACAAGGACAATCCAAGACTGCCTTTGTTACATTTAAAGATCCG
AAAGCGCTTGAAATTGCTTTGTTGTTGTCGGGAGCAACCATAGTGGATCAGATTGTAAATATTACTCAGGAAGAAGACTATGTTCCATCA
TCTGAGACTCGGGAAGTCAGGTTAGTTGATAATGCCGTGAATGTTGCTGGAGAAAGTTCTTCTCCGCTTGCTGAGGCCAAACCTACTTCT
CCTAGCAATGGAAGGGTGAACGGGAAAGTATATATCAGTAAAGCCCAAGATGTTGTCTCAAATGTGTTGGCAAAAGGTTCAGCTATCAGA
CAAGATGCAATGAATAAAGCCAAGGCATTTGATGAGAAACATCAGCTAAGAGCCACTGCATCTGCCCGAGTCATTTCCTTTGACCGAAGA
GTTGGGCTAACAGAAAAGCTTACGGTTGGAATTTCTGTTGTAAATGAGAAAGTTAAATCTGTTGATCAAAGGCTTCAAGTGTCAGACAAA
ACGATGGCTGCAGTTATGGCAGCAGAACGGAAATTGAATGACACAGGATCAGCGGTCAAATCAAGCAGGTATGTTAATGCTGGAGCTGCC
TGGCTGAATGGTGCTTTTAGTAAAGTAGCCAAGGCAGGGCAAGTTGCTGGTACAAAAACGAGAGAGAAATGGAATTTTGCATTGTCAAAT
TTGACAGCAAAGGATCCTTCTATTGTTGCCTAG\(3')ATCATAGCCGAATGTATGTTGGAGTTGCTAAGTTGCCTCTGTCAAATAGCTT
GGGATTCCAATAACTATTTCCTTGCACATCTAGAAATTGGGATCCGGTATGCAGATTGCAGATCGTCTGTGTCAAATTCAAGCAAGTTTT
ATCTGTGATGTGATTCTTTTCACTGTTAATTTTTCTTCCCATTTTATTGTGGAATGTGGAGTGGTGTGGTGAATACAACTATACGAGGTT
GTGTAATTCTTTTGTTTGTAAGCCTTCAAAGTCACGATAGGTTAGGAGCTTGTATTGATATCATATCTTTCTTGGTGAGGCTGAATTTTA
TTAGAAAGATTTCTGATTTGATGTTTATATTACGATGACATCCATCAGCATATATATTCACCTCTTAGATAAGTTTATTCATGTTAAAAA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan