ESTScan Details for Unigene SGN-U245822

Score 
821
Direction 
Forward
Predicted Peptide Sequence 
MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVKKKIERGVAFPTCISVNNTVCH
FSPLASDETVVEEGDILKIDMGCHIDGFIAVVGHTHVLHEGPVTGRAADVIAATNTAAEVALRLVRPGKKNSDVTEAIQKVAAAYAARIV
EGVLSHQXKQFVIDGX
Predicted Coding Sequence 
ATGTCGGACGACGAGAGAGAAGAGAAAGAATTGGATCTCACAAGTCCTGAGGTCGTCACCAAGTACAAGAGCGCCGCTGAAATTGTTAAC
AAGGCGCTGCAGTTGGTGTTGTCCGAATGCAAGCCAAAAGCAAAGATAGTTGATCTTTGTGAGAAAGGGGATGCCTTTATCAAAGAGCAA
ACTGGAAATATGTACAAGAATGTGAAGAAGAAGATTGAGAGAGGTGTTGCATTTCCAACATGTATTTCAGTTAATAACACCGTGTGCCAT
TTCTCTCCATTGGCTAGTGATGAGACAGTAGTGGAAGAAGGTGATATATTGAAGATTGATATGGGATGTCACATTGATGGATTTATTGCA
GTAGTTGGACATACACATGTTCTTCACGAAGGACCAGTTACTGGTAGAGCTGCTGATGTCATTGCAGCTACTAATACAGCTGCTGAAGTT
GCTTTGAGACTTGTAAGACCAGGAAAGAAGAACTCGGATGTAACAGAAGCTATTCAGAAGGTTGCTGCTGCCTATGCTGCAAGAATTGTC
GAGGGTGTATTGAGCCATCAATGNAAGCAGTTTGTTATTGATGGAAXX\
Edits in Original Sequence 
GGAAAGAGAAAAAAAAAATCTGTACTTTGTCTCCTTTTTATCACCTCATACACCTTTAACTTCACTAAAAACCCTAGCTTCCAAACCCTT
GTTGCCTCCATTTTTCTTCCATCGCAAAATCCCAATTTTGCTTCGAATTTGTGTGTTTGAATTAATAGCTGTTTTGTAACT
(5')ATGTC
GGACGACGAGAGAGAAGAGAAAGAATTGGATCTCACAAGTCCTGAGGTCGTCACCAAGTACAAGAGCGCCGCTGAAATTGTTAACAAGGC
GCTGCAGTTGGTGTTGTCCGAATGCAAGCCAAAAGCAAAGATAGTTGATCTTTGTGAGAAAGGGGATGCCTTTATCAAAGAGCAAACTGG
AAATATGTACAAGAATGTGAAGAAGAAGATTGAGAGAGGTGTTGCATTTCCAACATGTATTTCAGTTAATAACACCGTGTGCCATTTCTC
TCCATTGGCTAGTGATGAGACAGTAGTGGAAGAAGGTGATATATTGAAGATTGATATGGGATGTCACATTGATGGATTTATTGCAGTAGT
TGGACATACACATGTTCTTCACGAAGGACCAGTTACTGGTAGAGCTGCTGATGTCATTGCAGCTACTAATACAGCTGCTGAAGTTGCTTT
GAGACTTGTAAGACCAGGAAAGAAGAACTCGGATGTAACAGAAGCTATTCAGAAGGTTGCTGCTGCCTATGaCTGCAAGAATTGTCGAGG
GTGTATTGAGCCATCAATGNAAGCAGTTTGTTATTGATGGAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan