ESTScan Details for Unigene SGN-U246030

Score 
1093
Direction 
Forward
Predicted Peptide Sequence 
VRENERREKEKLKASVEAAGAGSSRDTRKLDLDGEAAQHQERNEDPEDAGSEREEEPVAGEGEGEGEGEEEEEKDEVPEVVHIEKGDGDS
VAKKVKPQLAAGFYEIETVRRRRTRKGQVQYLIKWRGWPETANTWEPEKNLLSCTDIIDAYEESLKSGKLRLTRKRKRKFGATQTQPKKK
QQQRSPAAATYNVPAVRVRIIEEPTPSPPLNVLKATNRVDSNGSELNSKVDKVVNGNGLRLREQNELNLKLSELKGAMSTNGNPVDISGN
GLANGFPKVNGAEFYQSDRCTGAKKRKSGCVRRFNXETTSAVKDDI
Predicted Coding Sequence 
GTTAGAGAGAATGAAAGAAGGGAAAAGGAAAAGCTCAAGGCTTCTGTTGAAGCCGCCGGAGCGGGGAGTAGCCGTGACACCCGCAAGTTG
GATTTGGACGGAGAAGCTGCTCAGCATCAAGAGAGAAATGAAGATCCTGAAGATGCCGGCAGCGAACGCGAGGAGGAACCGGTGGCCGGA
GAAGGAGAAGGAGAAGGAGAAGGAGAAGAAGAAGAAGAGAAGGATGAAGTGCCTGAGGTGGTTCATATAGAAAAAGGAGATGGCGATAGT
GTTGCTAAGAAGGTAAAACCACAACTTGCTGCAGGGTTTTACGAGATTGAAACTGTTAGGAGAAGGAGAACTCGAAAGGGTCAAGTCCAG
TATTTGATCAAATGGCGTGGCTGGCCGGAGACGGCAAATACATGGGAACCTGAGAAGAATCTGTTGTCCTGTACTGATATTATTGATGCA
TATGAAGAGAGCTTGAAGTCAGGGAAACTACGATTAACACGCAAGCGTAAGCGGAAGTTTGGGGCTACACAGACTCAACCCAAGAAAAAG
CAGCAGCAGCGTTCCCCTGCAGCAGCTACATATAATGTGCCAGCAGTGAGGGTTAGGATAATTGAGGAGCCTACACCCTCACCCCCTTTG
AATGTTTTGAAGGCTACAAATCGTGTGGACAGTAATGGTAGTGAATTGAACAGCAAAGTAGACAAAGTGGTGAATGGAAATGGTTTGAGA
TTGAGAGAGCAAAATGAGTTGAATTTGAAGCTGAGTGAATTAAAAGGAGCAATGTCAACCAATGGGAACCCTGTGGATATATCTGGTAAT
GGTCTCGCAAATGGATTTCCTAAGGTTAATGGTGCAGAATTTTATCAGTCTGATCGCTGTACTGGAGCTAAAAAGAGGAAATCTGGTTGT
GTTCGGAGATTTAACGXGGAGACTACCTCAGCTGTGAAGGATGATATC\
Edits in Original Sequence 
(5')GTTAGAGAGAATGAAAGAAGGGAAAAGGAAAAGCTCAAGGCTTCTGTTgGAAGCCGCCGGAGCGGGGAGTAGCCGTGACACCCGCA
AGTTGGATTTGGACGGAGAAGCTGCTCAGCATCAAGAGAGAAATGAAGATCCTGAAGATGCCGGCAGCGAACGCGAGGAGGAACCGGTGG
CCGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAGAAGAAGAAGAGAAGGATGAAGTGCCTGAGGTGGTTCATATAGAAAAAGGAGATGGCG
ATAGTGTTGCTAAGAAGGTAAAACCACAACTTGCTGCAGGGTTTTACGAGATTGAAACTGTTAGGAGAAGGAGAACTCGAAAGGGTCAAG
TCCAGTATTTGATCAAATGGCGTGGCTGGCCGGAGACGGCAAATACATGGGAACCTGAGAAGAATCTGTTGTCCTGTACTGATATTATTG
ATGCATATGAAGAGAGCTTGAAGTCAGGGAAACTACGATTAACACGCAAGCGTAAGCGGAAGTTTGGGGCTACACAGACTCAACCCAAGA
AAAAGCAGCAGCAGCGTTCCCCTGCAGCAGCTACATATAATGTGCCAGCAGTGAGGGTTAGGATAATTGAGGAGCCTACACCCTCACCCC
CTTTGAATGTTTTGAAGGCTACAAATCGTGTGGACAGTAATGGTAGTGAATTGAACAGCAAAGTAGACAAAGTGGTGAATGGAAATGGTT
TGAGATTGAGAGAGCAAAATGAGTTGAATTTGAAGCTGAGTGAATTAAAAGGAGCAATGTCAACCAATGGGAACCCTGTGGATATATCTG
GTAATGGTCTCGCAAATGGATTTCCTAAGGTTAATGGTGCAGAATTTTATCAGTCTGATCGCTGTACTGGAGCTAAAAAGAGGAAATCTG
GTTGTGTTCGGAGATTTAACGXGGAGACTACCTCAGCTGTGAAGGATGATATC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan