Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U246031

Score 
706
Direction 
Forward
Predicted Peptide Sequence 
VEVNFGAQPKLKTLDYFFLQAKQQQLAGKYVRLEVRXLKEPVTEPXQPFLDTDNGEELMHVQPGTAVVLGSRPPESPGTLYITSKQVVWL
SDTDRSKGYAVDFLSVSLHAVSRDPEAYRDPCLYAQIDNGVEDDESEGSSDEGDVSSDLSRITELRLVPSDPNQVDTLFQIFCDCAELNP
EPIEEEEEHNWIFSADQLENQEAEEDSEWMISPNSTHPIGRSNGDHDLAHNVLQLQINDQRFEDAEEMDSDTKNGHNHSXVKITFKCXEP
GGAFLISDSEFLVLLADLDEQSFCENDXEFYTGTSSXIMSQIVIHD
Predicted Coding Sequence 
GTCGAAGTTAATTTTGGCGCCCAACCTAAACTXAAAACCCTAGACTACTTTTTTTTGCAAGCTAAGCAACAGCAATTAGCCGGAAAATAT
GTCAGGCTTGAAGTTCGTCXGCTGAAAGAACCGGTGACGGAGCCGGXGCAGCCATTCCTGGACACCGACAACGGCGAGGAACTCATGCAT
GTTCAGCCTGGAACTGCTGTAGTCCTCGGCAGCCGCCCTCCTGAGTCACCTGGCACTCTCTATATCACCTCCAAGCAAGTGGTGTGGCTA
AGCGATACTGATAGGAGTAAAGGTTATGCAGTTGATTTCTTGTCTGTTTCACTTCATGCGGTCTCTAGAGACCCCGAGGCTTATCGGGAT
CCTTGTTTATATGCTCAGATTGACAATGGAGTGGAGGATGACGAATCAGAAGGTTCCAGTGATGAAGGTGATGTGTCATCAGATTTATCA
AGGATCACTGAGTTGAGACTTGTGCCATCAGATCCTAATCAAGTGGATACTCTCTTCCAGATCTTTTGTGATTGTGCTGAGCTTAATCCT
GAACCAATTGAAGAGGAGGAGGAACATAATTGGATCTTCAGCGCAGATCAGCTGGAAAATCAGGAAGCTGAAGAAGATTCTGAATGGATG
ATTTCTCCAAACTCTACACATCCAATTGGTCGTTCAAATGGGGATCACGACTTAGCTCATAATGTACTTCAGCTTCAGATTAATGATCAA
AGGTTTGAAGATGCGGAGGAAATGGACAGTGACACCAAAAATGGCCATAACCATTCCTAXGTCAAGATTACCTTTAAGTGTGXTGAACCT
GGTGGAGCTTTTCTCATTTCAGATTCAGAGTTTCTTGTGCTACTTGCTGATTTGGATGAACAGAGTTTTTGCGAAAATGATTAXGAATTC
TATACAGGAACTAGTAGTTNTATTATGTCACAAATAGTGATCCATGATTAA\
Edits in Original Sequence 
(5')GTCGAAGTTAATTTTGGCGCCCAACCTAAACTXAAAACCCTAGACTACTTTTTTTTGCtAAGCTAAGCAACAGCAATTAGCCGGAA
AATATGTCAGGCTTGAAGTTCGTCXGCTGAAAGAACCGGTGACGGAGCCGGXGCAGCCATTCCTGGACACCGACAACGGCGAGGAACTCA
TGCATGTTCAGCCTGGAACTGCTGTAGTCCTCGGCAGCCGCCCTCCTGAGTCACCTGGCACTCTCTATATCACCTCCAAGCAAGTGGTGT
GGCTAAGCGATACTGATAGGAGTAAAGGTTATGCAGTTGATTTCTTGTCTGTTTCACTTCATGCGGTCTCTAGAGACCCCGAGGCTTATC
GGGATCCTTGTTTATATGCTCAGATTGACAATGGAGTGGAGGATGACGAATCAGAAGGTTCCAGTGATGAAGGTGATGTGTCATCAGATT
TATCAAGGATCACTGAGTTGAGACTTGTGCCATCAGATCCTAATCAAGTGGATACTCTCTTCCAGATCTTTTGTGATTGTGCTGAGCTTA
ATCCTGAACCAATTGAAGAGGAGGAGGAACATAATTGGATCTTCAGCGCAGATCAGCTGGAAAATCAGGAAGCTGAAGAAGATTCTGAAT
GGATGATTTCTCCAAACTCTACACATCCAATTGGTCGTTCAAATGGGGATCACGACTTAGCTCATAATGTACTTCAGCTTCAGATTAATG
ATCAAAGGTTTGAAGATGCGGAGGAAATGGACAGTGACACCAAAAATGGCCATAACCATTCCTAXGTCAAGATTACCTTTAAGTGTGXTG
AACCTGGTGGAGCTTTTCTCATTTCAGATTCAGAGTTTCTTGTGCTACTTGCTGATTTGGATGAACAGAGTTTTTGCGAAAATGATTAXG
AATTCTATACAGGAACTAGTAGTTNTATTATGTCACAAATAGTGATCCATGATTAA\(3')TGCGAGCTGAGATGATATAGCTCAGTTGT
AGGTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan