ESTScan Details for Unigene SGN-U246277

Score 
729
Direction 
Forward
Predicted Peptide Sequence 
VDDPILKRLEVVKRKKERTKRGTLKISGIAVNQAGVASEQARSEIGRCRRNHRHSKKLRVVMSATAASILSGDGTIADVAAEHYXAEHSA
NQMALPQFGLHSSVRVCGDCFNNSSRPIGDGVIASASEVNALKDSFSALDVGAVADIKTEDTVKQTPTVGITDCKCGMPLCICQVSATPT
TSMASQGNIMPNPIVNINPKPKKENKIPTSRASTSDNKQGTTFNVGPATSCNTETMTVDYEVSGEGLREAIKNGDVGAAKKLLSQGVDAN
YLDKQGSSLLHLAAVFNRTEIAFALMESGSSLYCKNSQGETPLDCAPATXAIQNEKEDGREWAVTFHPEVTLLKSGYKDITVSEDGDLEP
IVLNIFVPPSKRLQEDVSSFKEVIRSY
Predicted Coding Sequence 
XXCGTAGATGACCCAATTTTGAAAAGATTAGAAGTTGTAAAAAGAAAAAAAGAAAGAACAAAAAGAGGTACTCTGAAAATATCAGGAATA
GCAGTGAATCAAGCGGGAGTTGCGAGCGAGCAAGCGAGATCGGAGATCGGAAGATGTCGTCGGAACCACCGCCATTCCAAGAAGCTTCGC
GTTGTGATGTCTGCAACTGCAGCTTCAATACTTTCCGGCGACGGCACCATTGCAGATGTTGCGGCCGAACATTATGXTGCTGAACATTCA
GCAAATCAGATGGCCTTGCCACAATTTGGTCTTCACTCAAGTGTTAGAGTTTGTGGAGATTGTTTTAATAACTCCTCTCGACCCATTGGA
GATGGCGTGATAGCTTCTGCAAGTGAAGTCAATGCCCTGAAAGATTCATTTTCAGCTTTAGATGTCGGTGCCGTTGCAGATATCAAAACT
GAAGACACTGTCAAGCAGACTCCTACTGTAGGCATCACAGACTGCAAATGTGGGATGCCTTTGTGTATATGTCAAGTGTCAGCTACACCA
ACAACATCCATGGCTTCACAGGGAAATATTATGCCAAATCCAATTGTAAATATAAATCCAAAACCAAAGAAGGAAAATAAAATTCCAACA
AGTAGAGCTTCGACATCAGACAACAAGCAAGGTACAACTTTCAATGTTGGTCCAGCTACCAGCTGCAATACGGAGACAATGACAGTGGAT
TATGAAGTCAGTGGCGAGGGTTTAAGGGAAGCAATAAAAAATGGTGATGTCGGCGCTGCAAAGAAGCTCCTAAGTCAGGGAGTTGATGCA
AATTACCTTGACAAGCAAGGATCATCATTGCTGCATCTGGCAGCGGTGTTCAATCGAACAGAAATAGCATTTGCACTCATGGAGAGTGGA
TCAAGTTTGTACTGCAAAAATTCACAAGGTGAGACACCATTGGATTGTGCTCCTGCCACAXTTGCAATTCAAAATGAAAAAGAAGATGGA
AGAGAGTGGGCAGTAACGTTTCATCCGGAAGTAACACTTCTCAAATCAGGCTACAAGGATATTACAGTTTCAGAGGATGGTGATCTAGAA
CCTATTGTTTTGAATATATTTGTACCCCCTAGTAAACGGCTACAAGAGGATGTCAGCAGTTTCAAAGAAGTAATCAGGTCCTATTAA\
Edits in Original Sequence 
(5')XXCGTAGATGACCCAATTTTGAAAAGATTAGAAGTTGTAAAAAGAAAAAAAGAAAGAACAAAAAGAGGTACTCTGAAAATATCAGG
AATAGCAGTGAATCAAGCGGGAGTTGCGAGCGAGCAAGCGAGATCGGAGATCGGAAGATGTCGTCGGAACCACCGCCATTCCAAGAAGCT
TCGCGTTGTGATGTCTGCAACTGCAGCTTCAATACTTTCCGGCGACGGCACCATTGCAGATGTTGCGGCCGAACATTATGXTGCTGAACA
TTCAGCAAATCAGATGGCCTTGCCACAATTTGGTCTTCACTCAAGTGTTAGAGTTTGTGGAGATTGTTTTAATAACTCCTCTCGACCCAT
TGGAGATGGCGTGATAGCTTCTGCAAGTGAAGTCAATGCCCTGAAAGATTCATTTTCAGCTTTAGATGTCGGTGCCGTTGCAGATATCAA
AACTGAAGACACTGTCAAGCAGACTCCTACTGTAGGCATCACAGACTGCAAATGTGGGATGCCTTTGTGTATATGTCAAGTGTCAGCTAC
ACCAACAACATCCATGGCTTCACAGGGAAATATTATGCCAAATCCAATTGTAAATATAAATCCAAAACCAAAGAAGGAAAATAAAATTCC
AACAAGTAGAGCTTCGACATCAGACAACAAGCAAGGTACAACTTTCAATGTTGGTCCAGCTACCAGCTGCAATACGGAGACAATGACAGT
GGATTATGAAGTCAGTGGCGAGGGTTTAAGGGAAGCAATAAAAAATGGTGATGTCGGCGCTGCAAAGAAGCTCCTAAGTCAGGGAGTTGA
TGCAAATTACCTTGACAAGCAAGGATCATCATTGCTGCATCTGGCAGCGGTGTTCAATCGAACAGAAATAGCATTTGCACTCATGGAGAG
TGGATCAAGTTTGTACTGCAAAAATTCACAAGGTGAGACACCATTGGATTGTGCTCCTGCCACAXTTGCAATTCAAAATGAAAAAGAAGA
TGGAAGAGAGTGGGCAGTAACGTTTCATCCGGAAGTAACACTTCTCtAAATCAGGCTACAAGGATATTACAGTTTCAGAGGATGGTGATC
TAGAACCTATTGTTTTGAcATATATTTGTACCCCCTAGTAAACGGCTACAAGAGGATGTCAGCAGTTTCAAAGAAGTAATCAGGTCCTAT
TAA\(3')TGTGTCACAAATTTGTATCAGATCAAGATTTCCTATTTTTCCATTTCTTTTTCTTTTCGTGTTTTTGCCTTCTCTCTATGCA
CAATAATGTATTTCAAGATGAAAAACAAGTACAGGGATAAACCACAGGCTTGTGGTTATTTCATGAATAAACACTTGGATTTTTGTTTCA
AAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan