ESTScan Details for Unigene SGN-U246818

Score 
535
Direction 
Forward
Predicted Peptide Sequence 
DESNSSSDVDRDALEDSGQGSSTPSADVETDELRDLLKSRVQCSDFLQKLENAQASVPQNLAEEGSSWDMVNENDLWEGGDPELDGEDYV
LVRQEDIVDGIACFMAAYLLSLKQTKDLTPNQLQDALSKTFSLKKKKGKLRKATAIGIYQNPAILSAASAASGLPACNIKALISSSSGLA
EIPRLSPARS
Predicted Coding Sequence 
GATGAATCCAATTCTAGCAGTGATGTTGACCGGGATGCTTTGGAAGATTCCGGTCAAGGCTCCTCTACTCCGTCTGCCGATGTTGAGACC
GATGAGCTGCGAGATCTCCTGAAATCTAGAGTTCAATGCTCAGATTTCCTTCAAAAGCTAGAAAATGCTCAAGCATCTGTTCCGCAAAAC
TTAGCTGAAGAAGGAAGTTCGTGGGACATGGTCAATGAGAATGACCTTTGGGAAGGTGGAGATCCTGAGTTAGACGGAGAAGACTATGTT
TTAGTTAGGCAAGAAGATATAGTGGATGGTATAGCTTGCTTTATGGCTGCATACCTGTTATCTCTTAAGCAGACTAAGGATTTGACACCA
AACCAACTCCAAGATGCTCTCAGCAAGACATTCTCTTTGAAAAAGAAGAAAGGAAAGCTCCGAAAGGCTACAGCTATTGGGATATACCAA
AACCCGGCTATTCTAAGTGCTGCATCAGCAGCATCTGGACTTCCTGCCTGTAATATCAAAGCTCTTATAAGCAGCAGTTCTGGCTTAGCT
GAAATCCCAAGGCTTTCGCCTGCACGAAGTTAA\
Edits in Original Sequence 
(5')GATGAATCCAATTCTAGCAGTGATGTTGACCGGGATGCTTTGGAAGATTCCGGTCAAGGCTCCTCTACTCCGTCTGCCGATGTTGA
GACCGATGAGCTGCGAGATCTCCTGAAATCTAGAGTTCAATGCTCAGATTTCCTTCAAAAGCTAGAAAATGCTCAAGCATCTGTTCCGCA
AAACTTAGCTGAAGAAGGAAGTTCGTGGGACATGGTCAATGAGAATGACCTTTGGGAAGGTGGAGATCCTGAGTTAGACGGAGAAGACTA
TGTTTTAGTTAGGCAAGAAGATATAGTGGATGGTATAGCTTGCTTTATGGCTGCATACCTGTTATCTCTTAAGCAGACTAAGGATTTGAC
ACCAAACCAACTCCAAGATGCTCTCAGCAAGACATTCTCTTTGAAAAAGAAGAAAGGAAAGCTCCGAAAGGCTACAGCTATTGGGATATA
CCAAAACCCGGCTATTCTAAGTGCTGCATCAGCAGCAtTCTGGACTTCCTGCCgTGTAATATCAAAGCTCTTATAAGCAGCAGTTCTGGC
TTAGCTGAAATCCCAAGGCTTTCGCCTGCACGAAGTTAA\(3')CGTTTGCTTGTGCCCTCCGGTTTAGGTTGTTGGTTCTTTAACGTGT
AATATAAGTGCCATTATTTGTTTAATCATGTAAATATTTCGCCAATTGAATAGCCTGCGTGCAGATTGATTGGGCTTAATCTGATGATCT
TGTTTGATTATTGAATCTCTCTACTGATTGCAGTTGATCATGATGCCTTCTGAATTATTTAGTAATTTACCGCCTTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan