Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U246887

Score 
459
Direction 
Forward
Predicted Peptide Sequence 
MATFAARSVLRSATSSARTAATRFAAGAKPKAAPSPFRMPTQKPLAARIFRSPVEMSCAVETMLPYHTATATAVADFNAXLLLLGVMVGL
LKIAMMMYDECQRVQAKFYIHAV
Predicted Coding Sequence 
ATGGCCACTTTCGCCGCCAGGTCCGTCCTCCGCTCTGCCACTTCCTCCGCCAGAACCGCTGCCACGAGATTCGCCGCCGGTGCCAAGCCC
AAGGCCGCTCCTTCTCCCTTTCGCATGCCCACTCAAAAACCCCTTGCTGCTCGCATTTTCAGGTCGCCTGTTGAAATGAGTTGTGCAGTG
GAAACTATGCTTCCTTATCACACTGCCACTGCTACTGCXGTTGCTGACTTCAATGCTXCTCTGCTACTCCTCGGAGTTATGGTTGGACTC
TTGAAGATTGCAATGATGATGTATGATGAATGTCAGAGAGTTCAAGCGAAGTTTTATATCCATGCAGTCTAA\
Edits in Original Sequence 
AAAACCCCAACAAAGCCCTTTTAGCATTTCACCGGTAGAAACACATCTCTCTCAGAGTTTTCCCCGATCCAAAA(5')ATGGCCACTTTC
GCCGCCAGGTCCGTCCTCCGCTCTGCCACTTCCTCCGCCAGAACCGCTGCCACGAGATTCGCCGCCGGTGCCAAGCCCAAGGCCGCTCCT
TCTCCCTTTCGCATGCCCACTCAAAAACCCCTTGCTGCTCGCATTTTCAGGTCGCCTGTTGAAATGAGTTGTGCAGTGGAAACTATGCTT
CCTTATCACACTGCCACTGCTACTGCXGTTGCTGACTTCAATGCTXCTCTGCTACTCCTCGGAGTTATGGTTGGACTCTTGAAGATTGCA
ATGATGATGTATGATGAATGTCAGAGAGTTCAAGCGAAGTTTTATATCCATGCAGTCTAA\(3')GCAAATGATAAGTAGAGTACTGAAT
GAGAACTTGGGACTCTTACCTTTCTGTGAATTCTGGCTTCTGTTGGACTGTGTTTTGGTATCTAGACGTTGGAGTCCTGTGGAAGCTCAT
TGTTATTAGATTTTGAGAGATGTTTAAAGCCTTAATTTGTCTCAAAAATGTTTTTATACAGGCCTTAATAATGTCATCTTTAACCTCTGG
TGTTTTATTGACCATATTTTTAGTTTCTTGGGAGTATTTGTTTGAACTTTGAAGCATCTAAAATTATATATTTGCTCCAAGTTGCTATTC
TTGCGTGATTAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan