ESTScan Details for Unigene SGN-U246950

Score 
615
Direction 
Forward
Predicted Peptide Sequence 
AKLDAARQGQYRKRTQFFSGIQNRAFINLYAFGVFLVSATKSCKSEEVNKNGEVNGGPDLENPHFFNAIRERELDLRGNKIPVIENLGAT
EDQFDTIDLSDNEIVKLENFPYLNRLGTLLMNNNRITRINPNIGEFLPKLHTLIITSNRLTNLVEIDPLASLPKLKFLSLLENNITKRPN
YRLYVIHKLKSLRLLDFRKVKQKERLEASKLFASQEAEEQVKKESVKTVPVEVAVPAEEPKEAQASKAVAPTPEQIIAIKAAIVNSQTLE
EVARLEQALKSGQLPADLNIGDHDVTAKKEDAKEDKMVTDSDDKAXQAEENVPEQKPDGPX
Predicted Coding Sequence 
XXTGCCAAACTAGACGCAGCCCGCCAAGGGCAATATCGTAAACGTACTCAGTTTTTCTCCGGTATACAGAACCGGGCTTTCATAAACCTT
TATGCATTTGGGGTTTTTCTTGTATCGGCTACTAAGAGCTGCAAAAGTGAAGAAGTGAACAAAAATGGTGAGGTTAACGGCGGACCTGAT
TTGGAAAACCCTCACTTCTTCAATGCCATTCGCGAACGCGAGTTAGATCTTCGAGGCAATAAGATTCCGGTCATTGAGAACTTAGGTGCA
ACCGAGGATCAGTTTGACACGATTGATTTATCTGATAATGAGATTGTTAAACTGGAGAATTTTCCATATCTGAATCGACTTGGAACTTTA
CTAATGAACAACAATAGAATTACGCGTATCAACCCTAACATTGGAGAGTTTCTGCCAAAATTGCATACTTTGATTATTACTAGCAACAGA
CTTACGAATTTGGTTGAAATTGACCCACTTGCGTCTCTCCCAAAGCTGAAGTTTCTTAGTCTTCTTGAGAACAATATCACAAAGAGACCA
AATTATCGCCTTTATGTCATTCACAAGTTGAAGTCCTTGCGTTTGCTGGATTTCAGGAAAGTCAAACAAAAGGAGAGATTGGAAGCAAGT
AAATTATTTGCATCACAAGAAGCTGAAGAGCAGGTCAAAAAGGAATCAGTGAAGACTGTACCTGTTGAGGTTGCGGTGCCTGCTGAGGAA
CCAAAGGAAGCTCAAGCATCTAAGGCAGTTGCTCCAACACCTGAGCAAATAATAGCAATTAAGGCTGCCATTGTGAATTCCCAAACTCTT
GAGGAGGTGGCTAGACTTGAACAGGCATTGAAGTCGGGCCAGCTTCCTGCAGATTTAAATATTGGTGATCATGATGTTACTGCTAAAAAA
GAAGATGCCAAAGAAGACAAGATGGTAACAGATAGCGATGATAAAGCTAAXCAGGCGGAGGAAAATGTACCTGAACAGAAACCTGATGGT
CCTAXX\
Edits in Original Sequence 
(5')XXTGCCAAACTAGACGCAGCCCGaCCAAGGGCAATATCGTAAACGTACTCtAGTTTTTCTCCGGTATACAGAACCGGGCTTTCATA
AACCTTTATGCAcTTTGGGGTTTTTCTTGTATCGGCTACTAAGAGCTGCAAAAGTGAAGAAGTGAcACAAAAATGGTGAGGTTAACGGCG
GACCTGATTTGGAAAAgCCCTCACTTCTTCAATGCCATTCGCGAACGCGAGTTAGATCTTCGAGGCAATAAGATTCCGGTCATTGAGAAC
TTAGGTGCAACCGAGGATCAGTTTGACACGATTGATTTATCTGATAATGAGATTGTTAAACTGGAGAATTTTCCATATCTGAATCGACTT
GGAACTTTACTAATGAACAACAATAGAATTACGCGTATCAACCCTAACATTGGAGAGTTTCTGCCAAAATTGCATACTTTGATTATTACT
AGCAACAGACTTACGAATTTGGTTGAAATTGACCCACTTGCGTCTCTCCCAAAGCTGAAGTTTCTTAGTCTTCTTGAGAACAATATCACA
AAGAGACCAAATTATCGCCTTTATGTCATTCACAAGTTGAAGTCCTTGCGTTTGCTGGATTTCAGGAAAGTCAAACAAAAGGAGAGATTG
GAAGCAAGTAAATTATTTGCATCACAAGAAGCTGAAGAGCAGGTCAAAAAGGAATCAGTGAAGACTGTACCTGTTGAGGTTGCGGTGCCT
GCTGAGGAACCAAAGGAAGCTCAAGCATCTAAGGCAGTTGCTCCAACACCTGAGCAAATAATAGCAATTAAGGCTGCCATTGTGAATTCC
CAAACTCTTGAGGAGGTGGCTAGACTTGAACAGGCATTGAAGTCGGGCCAGCTTCCTGCAGATTTAAATATTGGTGATCATGATGTTACT
GCTAAAAAAGAAGATGCCAAAGAAGACAAGATGGTAACAGATAGCGATGATAAAGCTAAXCAGGCGGAGGAAAATGTACCTGAACAGAAA
CCTGATGGTCCTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan