ESTScan Details for Unigene SGN-U247091

Score 
366
Direction 
Forward
Predicted Peptide Sequence 
ETSLYSQKLASKLFQDDGFIAAVAKSEPFDSNEYSKSRADIISLQTVFDPNGKPQKDNSSDPFLRNPSSGLVYGRLFVTGKHTRKSDILN
MLGSSRLSPDDVRFEYNMNYAPVSVMIQFPTRNSYEATLREGNRKGGLFRMERVGRQQWDTLPRYDGKTILLVGVPRNAVAEDVERFLAG
CQYDASAIQMFGRPQRAADRPPTRTVFVEFPSQAKATHAFIXEEQRLLS
Predicted Coding Sequence 
XXCGAAACTTCACTGTACTCTCAAAAATTAGCTTCGAAGTTGTTCCAAGATGATGGGTTTATTGCTGCTGTGGCTAAATCXGAACCGTTC
GATTCAAACGAGTATTCAAAATCAAGGGCTGACATTATCTCTCTGCAGACAGTTTTCGACCCAAATGGAAAACCCCAGAAGGACAATTCA
TCTGATCCATTCCTCCGAAACCCATCTTCTGGTTTGGTTTATGGGAGACTTTTTGTCACTGGAAAGCATACAAGGAAGAGTGACATTCTT
AACATGTTAGGGAGTTCTAGATTGAGCCCAGATGACGTTAGATTTGAGTACAACATGAACTATGCTCCAGTTTCAGTGATGATTCAGTTC
CCTACTCGAAATTCTTATGAGGCTACACTTAGGGAAGGAAATCGGAAGGGTGGCTTATTCAGAATGGAGAGGGTTGGTCGTCAACAGTGG
GACACTTTGCCACGCTATGATGGAAAAACTATTTTATTGGTAGGGGTCCCTCGAAATGCAGTTGCCGAAGATGTGGAACGTTTCCTTGCT
GGTTGCCAGTATGATGCATCAGCAATCCAAATGTTCGGCAGACCACAACGAGCTGCTGATAGACCACCAACTAGAACAGTCTTTGTGGAG
TTTCCCTCGCAGGCTAAGGCAACACATGCATTTATTXACGAAGAACAGAGGCTTCTGTCTTAA\
Edits in Original Sequence 
(5')XXCGAAACTTCACTGTACTCTCAAAAATTAGCTTCGAAGTTGTTCCAAGATGATGGGTTTATTGCgTGCTGTGGCTAAATCXGAAC
CGTTCGATTCAAACGAGTATTCAAAATCAAGGGCTGACATTATCTCTCTGCAGACAGTTTTCGACCCAAATGGAAAcACCCCAGAAGGAC
AATTCATCTGATCCATTCCTCCGAAACCCATCTTCTGGTTTGGTTTATGGGAGACTTTTTGTCACTGGAAAGCATACAAGGAAGAGTGAC
ATTCTTAACATGTTAGGGAGTTCTAGATTGAGCCCAGATGACGTTAGATTTGAGTACAACATGAACTATGCTCCAGTTTCAGTGATGATT
CAGTTCCCTACTCGAAATTCTTATGAGGCTACACTTAGGGAAGGAAATCGGAAGGGTGGCTTATTCAGAATGGAGAGGGTTGGTCGTCAA
CAGTGGGACACTTTGCCACGCTATGATGGAAAAACTATTTTATTGGTAGGGGTCCCTCGAAATGCAGTTGCCGAAGATGTGGAACGTTTC
CTTGCTGGTTGCCAGTATGATGCATCAGCAATCCAAATGTTCGGCAGACCACAACGAGCTGCTGATAGACCACCAACTAGAACAGTCTTT
GTGGAGTTTCCCTCGCAGGCTAAGGCAACACATGCATTTATTXACGAAGAACAGAGGCTTCTGTCTTAA\(3')TAACCAAATTACAGTG
CGACTTCTTCAGTAATCTCATCCATCTCCAAGATAATCTACGTTTTGTTTCCCTGTTGGTGATGCTCAATTGCTAGGATGTCGATGATGA
TTTGGAATGCTTGGATTGTGTACCTTCTTGTCCAGGCTTCAATCCTTCCATCAGAGAACTATTTTCATTTACGGTAGGAAAAGTTGAGAT
GAAAGTCCAAATAATATAACCTTATCAATATTTTGAATGACATTGTTTTGCAAAACTGTCCAAGGAGGGACCAAAAAGGAGATGTTCTTA
GCTTTTGTTTGGATTGTTTGTTCTTAGCTTTTGCTTGGATTGTTTGATCCAGTCATCAAGCGTTGTCTTTAGAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan