ESTScan Details for Unigene SGN-U247190

Score 
646
Direction 
Forward
Predicted Peptide Sequence 
VCDCGVKGVVQTAXPHFDCTESKSMASTTTSLTVRTFPSRCVLNANTNPPTKQAAAAXPGAEAVDLSGDGDNGTESAGYAVQGCGHWPLR
TEKEAKKVEEEAEELVKEGFEAADKGIAAAEKGIEAAEKGLVTAEKGIEAAEEKIESTVSFGGLAQAGAVAGAEFVGVLVAGAVVNGILG
PEPQKS
Predicted Coding Sequence 
GTTTGTGATTGTGGTGTCAAGGGAGTTGTGCAAACTGCAAAXCCTCATTTTGATTGCACAGAGAGCAAATCCATGGCTTCCACCACTACT
TCACTTACAGTAAGGACTTTCCCATCCCGTTGTGTGCTAAATGCAAACACAAATCCTCCTACCAAACAGGCGGCGGCGGCTXCTCCCGGG
GCGGAGGCAGTTGATCTCTCTGGTGACGGCGACAACGGTACTGAAAGCGCTGGATATGCCGTCCAAGGCTGCGGACATTGGCCTCTTCGG
ACTGAGAAAGAAGCTAAGAAAGTAGAAGAGGAGGCAGAAGAATTAGTGAAGGAGGGATTTGAGGCGGCAGACAAGGGAATCGCAGCAGCA
GAGAAGGGAATTGAAGCGGCGGAGAAAGGATTAGTGACGGCTGAGAAGGGGATTGAAGCAGCGGAGGAGAAGATCGAGAGTACAGTGAGT
TTCGGTGGGTTGGCGCAAGCTGGAGCGGTGGCCGGAGCTGAATTTGTTGGAGTTTTGGTTGCCGGAGCTGTTGTTAATGGTATTTTAGGA
CCTGAACCTCAAAAATCTTGA\
Edits in Original Sequence 
(5')GTTTGTGATTGTGGTGTCAAGGGAGTTGTGCAAACTGCAAAXCCTCATTTTGATTGCACAGAGAGCAAATCCATGGCTTCCACCAC
TACTTCACTTACAGTAAGGACTTTCCCATCCCGTTGTGTGCTAAATGCAAACACAAATCCTCCTACCAAACAGGCGGCGGCGGCTXCTCC
CGGGGCGGAGGCAGTTGATCTCTCTGGTGACGGCGACAACGGTACTGAAAGCGCTGGATATGCCGTCCAAGGCTGCGGACATTGGCCTCT
TCGGACTGAGAAAGAAGCtTAAGAAAGTAGAAGAGGAGGCAGAAGAATTAGTGAAGGAGGGATTTGAGGCGGCAGACAAGGGAATCGCAG
CAGCAGAGAAGGGAATTGAAGCGGCGGAGAAAGGATTAGTGACGGCTGAGAAGGGGATTGAAGCAGCGGAGGAGAAGATCGAGAGTACAG
TGAGTTTCGGTGGGTTGGCGCAAGCTGGAGCGGTGGCCGGAGCTGAATTTGTTGGAGTTTTGGTTGCCGGAGCTGTTGTTAATGGTATTT
TAGGACCTGAACCTCAAAAATCTTGA\(3')AAAGATTCTTGCTTTTCATTGTTGTTATTTGCAAATTAAATTTGCTAAATTCAAAGCAT
GGGCATTTCTATTAGTGTAACAATTAATCCTGTTATATAATATGTCTTTATAAATTATTTAACTCAAATTCTTGAAGATGATGTATGATG
TAGGATTACACTTGTTGTAAATAACAGAAAAATAACGAAAAAAAAAAAAAAAAAACTCGAGACTAGTCACCGGCGCTGAATACAAGAATC
GGGGATTATGAAGAAAAATTAGACAGTGACTGGTTAGTAGCATTCACTTCTGCATGTTCAATTTCAAATCTTGCAGATCTGATAAGGTAT
ATAAGGTTTTAGTCATTGCAAGACGAATGCACCATATGTCGACTGTCAACAGTACATATTCCCGAAATTGGGTGCTTTAGTTACCTCTAT
TGATTACATCTCTCTGCCTATATGCCAATTAACAAGCAACAGGCCTGTAAGATTGTACATAGCCCAGTAATGCTACTGATGAATGAAATG
CCCAATTATTTTCTACGACTCTTAACCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan