ESTScan Details for Unigene SGN-U247333

Score 
121
Direction 
Forward
Predicted Peptide Sequence 
ASASAYLSDGIFVNEGLTGRNLLQAKKPCPISFEFQNYTVVTTQCRGPQYPAKQCCEALAQFACPYSDYVNDLTTDCASTMFSYINLHGK
YPPGLFASECTGDKKGLPCPDSASSESASANNSHMSCXTITDPDDCNSYYGFVVVASLKPLQGFGVVSVFFIVKYCLNSGFSSTTLPLIN
NQQETXFEPPLVILDILXTAVTADTCVLKMTLLGNPR
Predicted Coding Sequence 
GCTTCAGCTTCAGCTTATTTATCAGATGGGATTTTTGTTAATGAAGGTTTAACTGGGAGGAATCTACTTCAAGCCAAGAAACCTTGTCCT
ATCAGCTTCGAGTTTCAAAACTACACAGTCGTCACTACCCAATGCAGAGGACCGCAATACCCAGCCAAACAATGTTGTGAAGCCCTTGCG
CAGTTTGCTTGTCCCTATTCAGACTATGTGAATGATTTGACAACTGATTGTGCCTCTACCATGTTCAGCTACATTAATCTTCACGGGAAG
TACCCACCCGGTCTTTTTGCCAGCGAGTGCACTGGTGACAAAAAGGGGCTACCATGTCCTGATTCTGCATCATCAGAATCTGCCAGTGCT
AATAATAGTCATATGAGCTGTAGXACTATCACCGATCCTGATGATTGTAACAGCTATTATGGGTTTGTTGTTGTTGCTTCTCTGAAGCCT
CTTCAAGGTTTTGGCGTAGTTTCTGTATTCTTTATTGTCAAATATTGTTTGAACTCCGGATTTTCTTCTACCACGTTACCACTGATTAAC
AATCAACAAGAAACTXCATTTGAGCCTCCTCTTGTAATTCTTGATATATTAXCAACAGCAGTTACTGCTGATACTTGTGTATTGAAAATG
ACTCTCCTTGGTAACCCGAGG\
Edits in Original Sequence 
TTAGCTGGCAAGAACTGAGATAACTTTGTTCAAAGGGAAAGAGAACAGATAGATCTCTTTCTATTTCTGGGTTTCTTTCAAAGATAACTT
TTTTCTGGGTTTTTGTTGAAATTTTCTTCCAAGAAATCATCTTTTTCCTTTTATAATTTGTTATTTTAGCTCATTTTGCTATGATGGAGT
GCAGACATTGTTTTTCTTGTATTTTTCTACTGTTTTCTTTCTTCATTTCA
(5')GCTTCAGCTTCAGCTTATTTATCAGATGGGATTTTT
GTTAATGAAGGTTTAACTGGGAGGAATCTACTTCAAGCCAAGAAACCTTGTCCTATCAGCTTCGAGTTTCAAAACTACACAGTCGTCACT
ACCCAATGCAGAGGACCGCAATACCCAGCCAAACAATGTTGTGAAGCCCTTGCGCAGTTTGCTTGTCCCTATTCAGACTATGTGAATGAT
TTGACAACTGATTGTGCCTCTACCATGTTCAGCTACATTAATCTTCACGGGAAGTACCCACCCGGTCTTTTTGCCAGCGAGTGCACTGGT
GACAAAAAGGGGCTACCATGTCCTGATTCTGCATCATCAGAATCTGCCAGTGCTAATAATAGTCATATGAGCTGTAGXACTATCACCGAT
CCTGATGATTGTAACAGCTATTATGGGTTTGTTGTTGTTGCTTCTCTGAAGaCCTCTTCAAGGTTTTGGCGTAGTTTCTGTATTCTTTAT
TGTCAAATATTGTTTGAACTCCGGATTTTCTTCTACCACGTTACCACTGATTAACAATCAACAAGAAACTXCATTTGAGCCTCCTCTTGT
AATTCTTGATATATTAXCAACAGCAGTTACTGCTGATACTTGTGTATTGAAAATGACTCTCCTTGGTAACCCGAGG\(3')ATCTGTTAA
AAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan