ESTScan Details for Unigene SGN-U247480

Score 
305
Direction 
Forward
Predicted Peptide Sequence 
ACVSSGMWGVGIMSNANSNRYSYLNNNKFSNNPSLVLSSSKGKRRIVASGEKESSSMATEIAGVKVINNPPQSKLTDLGVTSWPKWGCPP
SKFPWTYSAKETCYLLKGKVKVYPDGSNQAVEIGAGDLVEFPKGMSCTWDVSEEVDKHYKFE
Predicted Coding Sequence 
XXGGCTTGTGTAAGCAGTGGCATGTGGGGAGTGGGCATCATGAGTAATGCTAATTCGAATAGATATTCATATTTGAATAATAATAAATTT
AGCAACAACCCAAGTTTAGTACTAAGTAGTAGCAAGGGTAAAAGAAGGATAGTCGCATCAGGTGAAAAGGAATCAAGCAGCATGGCCACT
GAGATTGCCGGAGTGAAGGTCATTAACAACCCTCCCCAATCTAAACTCACTGACCTCGGCGTCACCTCTTGGCCCAAGTGGGGTTGTCCT
CCTAGCAAATTCCCATGGACATACTCTGCCAAAGAGACATGTTACTTGCTGAAGGGAAAGGTGAAGGTTTACCCTGATGGTTCTAATCAG
GCTGTTGAGATAGGCGCAGGCGACTTGGTTGAGTTCCCCAAAGGAATGAGCTGCACTTGGGATGTTTCTGAAGAAGTGGACAAGCATTAC
AAATTTGAGTAA\
Edits in Original Sequence 
(5')XXGGCTTGTGTAAGCAGTGGCATGTGGGGAGTGGGCATCATGAGTAATGCTAATTCGAATAGATATTCATATTTGAATAATAATAA
ATTTAGCAACAACCCAAGTTTAGTACTAAGTAGTAGCAAGGGTAAAAGAAGGATAGTCGCATCAGGTGAAAAGGAATCAAGCAGCATGGC
CACTGAGATTGCCGGAGTGAAGGTCATTAACAACCCTCCCCAATCTAAACTCACTGACCTCGGCGTCACCTCTTGGCCCAAGTGGGGTTG
TCCTCCTAGCAAATTCCCATGGACATACTCTGCCAAAGAGACATGTTACTTGCTGAAGGGAAAGGTGAAGGTTTACCCTGATGGTTCTAA
TCAGGCTGTTGAGATAGGCGCAGGCGACTTGGTTGAGTTCCCCAAAGGAATGAGCTGCACTTGGGATGTTTCTGAAGAAGTGGACAAGCA
TTACAAATTTGAGTAA\(3')ATGAGTTCAATCACCAGAGCCTTCTTATGTATTGGAATTTTCTTCCTTCACCAAATTAGTGTAACGCTG
TTGTGATTTCTACATTTCACTGTTAAGAGTTTGGATATGGTTGAGGTTTATGTACTAATTGGCTGTATGCCTTAATGAGATAGCTTTTGG
CTATTAGCTAAAAAAAAAANNNNNNNAANAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan