Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U247509

Score 
981
Direction 
Forward
Predicted Peptide Sequence 
MEFLERPDAQLIIGVAVAAVAVGATAYFYFSSKKSKVCLNPEEFRAFKLVKRTQLSHNVAKFRFELPTPTSVLGLPIGQHISCRGKDSQG
EEVVKPYTPTTLDSDIGYFELVIKMYPQGRMSHHFREMREGDYMEVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPNDAT
KVHLIYANVTSEDILLKEELEGLTANYPDRFKVYYVLNQPPEEWSGGVGFVSKEMIQTHCPAPADDIKILRCGPPPMNKAMAAHLDALGY
SPEMQFQF
Predicted Coding Sequence 
ATGGAGTTCTTGGAAAGACCTGATGCTCAATTGATTATTGGGGTTGCTGTTGCAGCTGTTGCTGTTGGTGCTACAGCTTATTTTTACTTC
TCTTCCAAGAAGTCCAAAGTATGTTTAAACCCTGAAGAATTCAGGGCATTTAAGCTTGTGAAGCGCACACAACTTAGCCATAATGTGGCG
AAATTCAGATTTGAACTTCCAACGCCCACTTCTGTGTTGGGACTACCCATTGGACAACATATTAGTTGCAGGGGCAAAGATAGTCAAGGT
GAAGAGGTTGTTAAACCATACACACCAACTACTTTGGACTCGGACATTGGATATTTTGAGTTAGTTATAAAGATGTATCCCCAAGGAAGG
ATGTCACATCATTTTCGGGAGATGCGTGAGGGTGATTATATGGAAGTGAAGGGACCCAAGGGCCGCTTTAAGTACCAGCCCGGACAAGTT
AGAGCATTTGGAATGCTTGCAGGAGGCTCTGGCATTACCCCAATGTTCCAGGTTGCTAGAGCTATTCTTGAAAATCCTAATGACGCGACA
AAGGTGCACCTGATATATGCTAATGTTACTTCTGAAGATATTCTTTTGAAGGAAGAGTTGGAGGGTCTTACTGCTAACTATCCTGACCGT
TTCAAAGTTTATTATGTCTTGAATCAGCCTCCGGAAGAATGGAGTGGTGGTGTGGGATTTGTCTCCAAGGAAATGATCCAGACTCATTGC
CCTGCCCCAGCAGATGACATTAAGATACTGAGGTGTGGTCCACCACCGATGAACAAGGCAATGGCTGCTCATCTTGATGCCCTTGGATAT
TCACCGGAGATGCAGTTCCAATTCTAA\
Edits in Original Sequence 
TGGTACTGTATTACTGTTCTTCAAGATTCATCTTTTCTGATTTTTTATTTTTGAGAA(5')ATGGAGTTCTTGGAAAGACCTGATGCTCA
ATTGATTATTGGGGTTGCTGTTGCAGCTGTTGCTGTTGGTGCTACAGCTTATTTTTACTTCTCTTCCAAGAAGTCCAAAGTATGTTTAAA
CCCTGAAGAATTCAGGGCATTTAAGCTTGTGAAGCGCACACAACTTAGCCATAATGTGGCGAAATTCAGATTTGAACTTCCAACGCCCAC
TTCTGTGTTGGGACTACCCATTGGACAACATATTAGTTGCAGGGGCAAAGATAGTCAAGGTGAAGAGGTTGTTAAACCATACACACCAAC
TACTTTGGACTCGGACATTGGATATTTTGAGTTAGTTATAAAGATGTATCCCCAAGGAAGGATGTCACATCATTTTCGGGAGATGCGTGA
GGGTGATTATATGGAAGTGAAGGGACCCAAGGGCCGCTTTAAGTACCAGCCCGGACAAGTTAGAGCATTTGGAATGCTTGCAGGAGGCTC
TGGCATTACCCCAATGTTCCAGGTTGCTAGAGCTATTCTTGAAAATCCTAATGACGCGACAAAGGTGCACCTGATATATGCTAATGTTAC
TTCTGAAGATATTCTTTTGAAGGAAGAGTTGGAGGGTCTTACTGCTAACTATCCTGACCGTTTCAAAGTTTATTATGTCTTGAATCAGCC
TCCGGAAGAATGGAGTGGTGGTGTGGGATTTGTCTCCAAGGAAATGATCCAGACTCATTGCCCTGCCCCAGCAGATGACATTAAGATACT
GAGGTGTGGTCCACCACCGATGAACAAGGCAATGGCTGCTCATCTTGATGCCCTTGGATATTCACCGGAGATGCAGTTCCAATTCTAA\
(3')CTTCTTTTTCTGTTTTCATTTTTATCCCCACATTAAAATTAACCTCGATTACAAGGGGTTGCGTTTTATACATTTTTCAGTGAAGAG
ATTCAAAACCATGCTTTCAAGTTTGAATAACATCTCATCCTTGAGTAGAAATGTCCTCTATGCTATTCTGGTCTTGATTCAAAGTGCACT
AACATCAAAGTAACAGTTGAGTTGATTGCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan