ESTScan Details for Unigene SGN-U247660

Score 
1089
Direction 
Forward
Predicted Peptide Sequence 
NTIWRPTVAGFLLRPVVSAKGLLRMANINNKDEPSTAPLPDRWYNLSLGSSFKDHQPSSKFCTLRYEFKPASIDKNQPGKLHKTKDNKIS
VEFQNNQPGKPKVSFDGSSEDYKENDAVLFFDGESFRLERLHRAVKRLRYNRLPGESAAAVAPAPAPGPSRSPAPSPIGMPVETRSPPVV
KGAKFQSLNKPAVPAPAVPVEVERIEVGDFRSSDSRPKNEKIAEYPSSHANHSTASPVMKYDDLDEQLDILNDDEDDTTAANGGNVTVEE
FKTGIDINIPHQNDTDDEIADVDVSDDDEDKGRNAAEELRAQVNAEGKENHTSSSSSSSSSDSSGSGSGSGSGSGSDSASSSSDNESSDT
VNSI
Predicted Coding Sequence 
AACACAATTTGGCGACCCACCGTTGCTGGTTTTCTTCTCCGACCCGTCGTGTCGGCCAAGGGGCTACTGAGAATGGCAAACATAAACAAC
AAAGATGAACCAAGTACAGCGCCACTGCCAGATCGGTGGTACAATTTGAGTCTAGGTTCTTCCTTTAAAGATCACCAACCTTCTTCAAAG
TTCTGTACTTTACGATATGAATTTAAACCTGCTTCAATTGATAAGAACCAACCTGGAAAATTACACAAGACCAAGGACAATAAGATTTCT
GTTGAATTTCAAAATAACCAGCCTGGTAAACCTAAGGTATCCTTTGATGGAAGTAGTGAGGATTACAAGGAAAATGATGCTGTTCTTTTC
TTTGATGGTGAGTCATTTCGGTTGGAGCGGTTACATAGGGCAGTTAAGCGGTTGAGGTATAATCGACTCCCCGGAGAATCCGCTGCGGCA
GTAGCACCTGCACCCGCACCTGGTCCTTCTCGTTCTCCTGCTCCTTCTCCAATTGGAATGCCTGTAGAGACGCGTTCACCACCAGTTGTC
AAAGGGGCAAAATTTCAGTCACTTAATAAGCCTGCAGTTCCTGCACCTGCTGTGCCAGTTGAGGTGGAAAGGATCGAAGTTGGTGACTTT
AGAAGTTCAGATTCAAGACCCAAAAATGAGAAGATTGCTGAGTATCCATCTTCACATGCAAATCATTCAACTGCATCACCAGTCATGAAG
TATGATGACCTGGATGAACAATTAGATATACTGAATGATGATGAGGATGATACTACCGCAGCCAATGGTGGGAATGTTACTGTTGAAGAA
TTCAAAACTGGCATTGATATTAATATCCCACACCAAAATGATACAGATGATGAGATAGCTGATGTGGATGTAAGTGATGATGATGAGGAC
AAGGGCCGCAATGCTGCAGAAGAACTTAGAGCTCAAGTAAATGCAGAGGGAAAAGAGAATCATACTTCGAGTTCTAGCAGTAGCAGCAGC
AGTGACAGTAGTGGAAGTGGGAGTGGGAGCGGGAGTGGAAGTGGAAGTGATAGTGCAAGCAGCAGCAGTGACAATGAAAGCAGTGACACG
GTCAACTCTATCTGA\
Edits in Original Sequence 
(5')AACACAATTTGGCGACCCACCGTTGCTcGGTTTTCTTCTCCGACCCGTCGTGTCGGCCAAGGGGCTACTGAGAATGGCAAACATAA
ACAACAAAGATGAACCAAGTACAGCGCCACTGCCAGATCGGTGGTACAATTTGAGTCTAGGTTCTTCCTTTAAAGATCACCAACCTTCTT
CAAAGTTCTGTACTTTACGATATGAATTTAAACCTGCTTCAATTGATAAGAACCAACCTGGAAAATTACACAAGACCAAGGACAATAAGA
TTTCTGTTGAATTTCAAAATAACCAGCCTGGTAAACCTAAGGTATCCTTTGATGGAAGTAGTGAGGATTACAAGGAAAATGATGCTGTTC
TTTTCTTTGATGGTGAGTCATTTCGGTTGGAGCGGTTACATAGGGCAGTTAAGCGGTTGAGGTATAATCGACTCCCCGGAGAATCCGCTG
CGGCAGTAGCACCTGCACCCGCACCTGGTCCTTCTCGTTCTCCTGCTCCTTCTCCAATTGGAATGCCTGTAGAGACGCGTTCACCACCAG
TTGTCAAAGGGGCAAAATTTCAGTCACTTAATAAGCCTGCAGTTCCTGCACCTGCTGTGCCAGTTGAGGTGGAAAGGATCGAAGTTGGTG
ACTTTAGAAGTTCAGATTCAAGACCCAAAAATGAGAAGATTGCTGAGTATCCATCTTCACATGCAAATCATTCAACTGCATCACCAGTCA
TGAAGTATGATGACCTGGATGAACAATTAGATATACTGAATGATGATGAGGATGATACTACCGCAGCCAATGGTGGGAATGTTACTGTTG
AAGAATTCAAAACTGGCATTGATATTAATATCCCACACCAAAATGATACAGATGATGAGATAGCTGATGTGGATGTAAGTGATGATGATG
AGGACAAGGGCCGCAATGCTGCAGAAGAACTTAGAGCTCAAGTAAATGCAGAGGGAAAAGAGAATCATACTTCGAGTTCTAGCAGTAGCA
GCAGCAGTGACAGTAGTGGAAGTGGGAGTGGGAGCGGGAGTGGAAGTGGAAGTGATAGTGCAAGCAGCAGCAGTGACAATGAAAGCAGTG
ACACGGTCAACTCTATCTGA\(3')GAACTTAAAGTATTTTGAGGGTGAATGTCTCAAGTTTGAAATAATTCAAAGAGAAGCCACTACAT
TGCTTTTAGGTTCAGTTGATCGACAATGCAGTCGAGGATCAGGCCAAATCTCTATTGGCATGTCCTCTTATTTTGCTCTTCTTCTTGCAG
TATAACTTTCTCCTTCCTGCTATTCTCCTTCTATTTATCTCATTTTTAGACTTTTATGTAAGAGGTACAGAAAACTGAAGAAGTTTGTAC
GACAGGAAAGATGATTACTGTATCTGTTGTATTGTAAATGCATCAAATATTTTCAAGCCTGGCACCTTTTAGTTCTCATTTACTGGTTGT
TGGAGAAGAGAAGAAATGTGAAAGAAACCTTCATTTTCGTTGGTTGATGGTACAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan