ESTScan Details for Unigene SGN-U247883

Score 
483
Direction 
Forward
Predicted Peptide Sequence 
VFQRQIKLVIYNLKQAIDEADGFQNTHQMKQYESAKLSIDPGDFQLEKVYIXMAPFTPTFCIQEKYEHGAGGSLFRIANDILLLDDIAAE
EXIAAPKADSSAIRESSSFLDSVLAINQTGKLQESPAQTLDDLIPSLRKLRKLADLLDMPLKSITAAWETDELANHGFKQSEVEDFIRAI
FADSPLRKDAYEE
Predicted Coding Sequence 
GTTTTTCAAAGACAAATTAAACTTGTCATTTACAACCTAAAACAGGCTATTGATGAAGCCGATGGATTTCAAAATACTCATCAAATGAAG
CAATATGAATCTGCTAAGTTGAGCATTGACCCAGGTGATTTTCAACTTGAGAAAGTATATATTXATATGGCACCGTTTACTCCTACCTTC
TGCATACAAGAGAAGTATGAGCATGGTGCTGGAGGAAGTCTTTTCAGAATAGCAAATGATATCCTCCTCCTAGACGATATTGCTGCAGAA
GAAXACATTGCAGCTCCAAAGGCTGATTCATCTGCTATTCGAGAATCTTCTTCTTTCTTGGACTCTGTATTGGCTATTAACCAGACAGGA
AAGTTGCAGGAATCTCCTGCACAAACTCTTGATGATCTTATACCATCCCTCCGGAAATTACGCAAGCTAGCAGATCTCTTGGATATGCCA
TTGAAATCTATTACTGCAGCTTGGGAAACTGATGAACTTGCCAACCATGGTTTTAAGCAATCAGAGGTTGAAGACTTCATCCGAGCCATA
TTTGCAGATTCACCTCTGAGGAAAGATGCTTACGAAGAATAG\
Edits in Original Sequence 
(5')GTTTTTCAAAGACAAATTAAACTTGTCATTTACAACCTAAAACAGGCTATTGATGAAGCCGATGGATTTCAAAATACTCATCAAAT
GAAGCAATATGAATCTGCTAAGTTGAGCATTGACCCAGGTGATTTTCAtACTTGAGAAAGTATATATTXATATGGCACCGTTTACTCCTA
CCTTCTGCATACAAGAGAAGTATGAGCATGGTGCTGGAGGAAGTCTTTTCtAGAATAGCAAATGATATCCTCCTCCTAGACGATATTGCT
GCAGAAGAAXACATTGCAGCTCCAAAGGCTGATTCATCTGCTATTCGAGAATCTgTCTTCTTTCTTGGACTCTGTATTGGCTATTAACCA
GACAGGAAAGTTGCAGGAATCTCCTGCACAAACTCTTGATGATCTTATACCATCCCTCCGGAAATTACGCAAGCTAGCAGATCTCTTGGA
TATGCCATTGAAATCTATTACTGCAGCTTGGGAAACTGATGAACTTGCCAACCATGGTTTTAAGCAATCAGAGGTTGAAGACTTCATCCG
AGCCATATTTGCAGATTCACCTCTGAGGAAAGAgTGCTTACGAAGAATAG\(3')AAAGTAGATATTACCAAGCTTTCAGTTACAGTTAG
CTCATTGGTTGCTACAGCTAGAAGTTTTACTTGTGTTGGATCTCTCTCAACCTCGATAAGTTGCTTGCGATCATTTTTTTCTTTGTTGCT
TCAGGAGACTTTTATAGTCCATTTATTCTATAAGTTTTAAAATCAATGAATTGCTATCTTTATGTATTTAGTGGAGTTTGGCAGTTCGAA
CTTCGAACCATAGAATCTACTTGATAGGCTTCTTCATGTGAAATGTAAATCTGTTCATTGTACATTTATGAGAATAGCATACTGCTGACA
GAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan