ESTScan Details for Unigene SGN-U248061

Score 
611
Direction 
Forward
Predicted Peptide Sequence 
MAEGGEEDLPRDAKIVKTLLKSMGVDDYEPRVVQQFLELWYRYVVDVLTDAQVYSEHAGKASIDSDDIKLAIQQKLISASHNPRRXEVLL
ELARNRNKIPLPKSIAGSGVPLPPQQDTLINPNYQLAIAKKQTSQPEETEEDEESADPNPAPSKNPSLSHEKTDYLKVLLNEYPFPLALN
VQDDVLCLISFSHKSLCNRLPMYLIKGIV
Predicted Coding Sequence 
ATGGCTGAAGGTGGAGAAGAGGACTTGCCAAGGGATGCAAAGATTGTCAAAACGTTGCTAAAATCAATGGGTGTTGATGACTACGAGCCT
CGAGTTGTGCAACAATTTTTGGAACTGTGGTATCGCTATGTTGTTGATGTACTGACGGATGCTCAAGTCTACTCAGAGCATGCAGGGAAG
GCTTCCATTGACTCTGATGACATCAAGCTTGCCATTCAGCAAAAGTTAATTTCAGCTTCTCACAACCCCCGCCGCGXTGAGGTCCTACTG
GAGTTGGCTAGGAACAGAAACAAGATTCCGTTGCCGAAATCAATTGCTGGGTCTGGAGTACCACTCCCTCCTCAACAAGATACATTGATC
AACCCTAACTATCAGCTAGCTATTGCAAAGAAGCAAACTAGCCAACCAGAAGAAACAGAGGAGGACGAAGAAAGCGCTGATCCCAACCCA
GCTCCAAGCAAAAATCCAAGTCTTTCTCATGAAAAGACAGACTACCTCAAGGTACTCCTCAACGAGTATCCTTTCCCCTTGGCGCTAAAC
GTCCAAGATGATGTCTTATGTTTGATCAGCTTTAGTCACAAGAGCCTTTGTAACCGTCTGCCTATGTATTTAATCAAAGGCATTGTATAA
\
Edits in Original Sequence 
CTTCATCAAATTTTATGTATGTATCTCCTTCATCTTTTGTCTGCTCAGTGCTTTTGGTTCTTCGTTTAATCTTGCCTCTTGCTCGAATTG
TGGTGCATCTTCGGTTGAACCTTGAAAGAA
(5')ATGGCTGAAGGTGGAGAAGAGGACTTGCCAAGGGATGCAAAGATTGTCAAAACGTT
GCTAAAATCAATGGGTGTTGATGACTACGAGCCTCGAGTTGTGCAACAATTTTTGGAACTGTGGTATCGCTATGTTGTTGATGTACTGAC
GGATGCTCAAGTCTACTCAGAGCATGCAGGGAAGGCTTCCATTGACTCTGATGACATCAAGCTTGCCATTCAGtCAAAAGTTAATTTCAG
CTTCTCACAACCCCCGCCGCGXTGAGGTCCTACTGGAGTTGGCTAGGAACAGAAACAAGATTCCGTTGCCGAAATCAATTGCTGGGTCTG
GAGTACCACTCCCTCCTCAACAAGATACATTGATCAACCCTAACTATCAGCTAGCTATTGCAAAGAAGCAAACTAGCCAACCAGAAGAAA
CAGAGGAGGACGAAGAAAGCGCTGATCCCAACCCAGCTCCAAGCAAAAATCCAAGTCTTTCTCATGAAAAGACAGACgTACCTCAAGGTA
CTCCTCAACGAGTATCCTTTCCCCTTGGCGCTAAACGTCCAAGATGATGTCTTATGTTTGATCAGCTTTAGTCACAAGAGCCTTTGTAAC
CGTCTGCCTATGTATTTAATCAAAGGCATTGTATAA\(3')TTGTTGTTTAAACATGAAGTATGAAACTTTAAGATCCTTTTGTAACAGT
GAGTATCAGTTTAAATGCTCCTCCTTCCAGTATTTATTTATTAGACACAATTAGCAGGAGTTGAGCTGTGAAATGAAGAATTACTTTGGC
ATTATCAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan