ESTScan Details for Unigene SGN-U248197

Score 
631
Direction 
Forward
Predicted Peptide Sequence 
MGKDSKSKDSGSKGKGKQAAGGSEDGVSKGKGKAGKGDGLGTCTYVKARHVLCEKQSKINEAYKILQEGWLNNGDKVPPAEFAKVAAAYS
ECPSGKKGGDLGWFPRGKMAGPFQEVAFNTPVGATSAPFKSTHGYHFILSEGGRTEISEHLDRHGMVAVVAEK
Predicted Coding Sequence 
ATGGGAAAGGATTCCAAGTCTAAGGATTCTGGAAGCAAGGGAAAGGGTAAACAGGCAGCTGGTGGAAGCGAGGATGGTGTTTCGAAAGGA
AAAGGAAAAGCTGGGAAAGGAGATGGCCTTGGAACCTGCACATATGTTAAAGCAAGGCATGTCTTATGTGAGAAGCAGTCAAAGATTAAT
GAAGCATACAAAATACTACAGGAAGGCTGGCTGAACAACGGAGATAAAGTTCCACCAGCTGAGTTTGCCAAGGTAGCTGCAGCTTACTCG
GAATGCCCCTCAGGAAAGAAAGGTGGGGACCTGGGATGGTTTCCACGTGGCAAGATGGCAGGCCCATTTCAGGAAGTTGCCTTCAATACC
CCTGTTGGAGCTACCAGTGCACCCTTTAAATCAACACATGGATACCATTTCATTTTATCTGAAGGAGGAAGAACTGAGATCTCTGAGCAT
TTAGATAGACATGGGATGGTGGCAGTTGTAGCAGAGAAATGA\
Edits in Original Sequence 
TGGATCCCCGGGCTGCAGGCCGAGATAGATACTCTTCGCAGTCTTGCCTCTCTGAAGTTGAAACTCTCTCTCTCAATTCTCAAACAATCA
AATTCTGAGAAGTT
(5')ATGGGAAAGGATTCCAAGTCTAAGGATTCTGGAAGCAAGGGAAAGGGTAAACAGGCAGCTGGTGGAAGCGAG
GATGGTGTTTCGAAAGGAAAAGGAAAAGCTGGGAAAGGAGATGGCCTTGGAACCTGCACATATGTTAAAGCAAGGCATGTCTTATGTGAG
AAGCAGTCAAAGATTAATGAAGCATACAAAATACTACAGGAAGGCTGGCTGAACAACGGAGATAAAGTTCCACCAGCTGAGTTTGCCAAG
GTAGCTGCAGCTTACTCGGAATGCCCCTCAGGAAAGAAAGGTGGGGACCTGGGATGGTTTCCACGTGGCAAGATGGCAGGCCCATTTCAG
GAAGTTGCCTTCAATACCCCTGTTGGAGCTACCAGTGCACCCTTTAAATCAACACATGGATACCATTTCATTTTATCTGAAgGGAGGAAG
AACTGAGATCTCTGAGCATTTAGATAGACATGGGATGGTGGCAGTTGTAGCAGAGAAATGA\(3')CTATTTGGTCATCTGATACTTATT
GCTGAGACTATCTTCTGGTTAAGTTAATAAAATGCAACTGGTGTGTGGATTGCAAGTGTAATGATAAACAAGTAAACATGTCAATGATTG
GATCAAAGTATCTTACTGGCTCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan