ESTScan Details for Unigene SGN-U248235

Score 
507
Direction 
Forward
Predicted Peptide Sequence 
MASSSEKRCLYEVLGVSRDCTADEIRSAYRKLALQRHPDKLVRSGVPESEATASFQELVNAYEVLSDARERLVYSGYSDKGKGFYKVYGD
LFEKIYQHDLNFARKLGTDLPKEAPLMGNLESPYAQVTAFYSYWLGFVTVMDYCWADQYDVMAGPNRKSRRVMEDENKKLRKKARREYNE
TVRGLAEFVKKRDKRVIDMQMKRNEEMEKKKEEERKRRKELEREKAERARNYVEPEWX
Predicted Coding Sequence 
ATGGCGTCGTCGTCGGAGAAAAGGTGCCTATACGAGGTCCTCGGCGTGAGCCGTGACTGCACGGCCGATGAGATCAGGTCCGCTTACAGA
AAGCTAGCGCTGCAACGCCACCCTGACAAGCTGGTTCGATCTGGCGTGCCGGAATCCGAAGCAACAGCTTCTTTTCAGGAGCTTGTGAAT
GCTTACGAGGTTCTATCGGACGCACGGGAGCGCCTTGTGTATTCTGGATATTCAGATAAAGGGAAGGGATTTTACAAGGTGTATGGTGAT
CTTTTCGAGAAAATCTACCAACACGATTTAAATTTCGCGAGGAAGTTAGGTACAGATTTGCCAAAAGAAGCTCCTCTCATGGGAAATTTG
GAGAGTCCTTATGCTCAGGTGACTGCATTCTATAGCTATTGGCTAGGATTCGTTACTGTGATGGACTATTGTTGGGCAGATCAGTATGAC
GTGATGGCAGGACCTAATAGAAAGTCCAGGCGGGTGATGGAGGATGAGAACAAGAAGCTGAGGAAAAAGGCGCGAAGGGAATACAATGAG
ACTGTTAGAGGATTAGCAGAGTTTGTGAAAAAGAGAGATAAGAGAGTGATTGACATGCAGATGAAGAGGAACGAGGAAATGGAGAAGAAA
AAGGAAGAGGAACGCAAGAGAAGGAAGGAGCTGGAGAGAGAGAAGGCTGAGAGAGCAAGAAACTACGTAGAGCCTGAGTGGAXX\
Edits in Original Sequence 
CTTTCTTTCCCGGCGATA(5')ATGGCGTCGTCGTCGGAGAAAAGGTGCCTATACGAGGTCCTCGGCGTGAGCCGTGACTGCACGGCCGA
TGAGATCAGGTCCGCTTACAGAAAGCTAGCGCTGCAACGCCACCCTGACAAGCTGGTTCGATCTGGCGTGCCGGAATCCGAAGCAACAGC
TTCTTTTCAGGAGCTTGTGAATGCTTACGAGGTTCTATCGGACGCACGGGAGCGCgCTTGTGTATTCTGGATATTCAGATAAAGGGAAGG
GATTTTACAAGGTGTATGGTGATCTTTTCGAGAAAATCTACCAACACGATTTAAATTTCGCGAGGAAGTTAGGTACAGATTTGCCAAAAG
AAGCTCCTCTCATGGGAAATTTGGAGAGTCCTTATGCTCAGGTGACTGCATTCTATAGCTATTGGCTAGGATTCGTTACTGTGATGGACT
ATTGTTGGGCAGATCAGTATGACGTGATGGCAGGACCTAATAGAAAGTCCAGGCGGGTGATGGAGGATGAGAACAAGAAGCTGAGGAAAA
AGGCGCGAAGGGAATACAATGAGACTGTTAGAGGATTAGCAGAGTTTGTGAAAAAGAGAGATAAGAGAGTGATTGACATGCAGATGAAGA
GGAACGAGGAAATGGAGAAGAAAAAGGAAGAGGAACGCAAGAGAAGGAAGGAGCTGGAGAGAGAGAAGGCTGAGAGAGCAAGAAACTACG
TAGAGCCTGAGTGGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan