Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U248280

Score 
856
Direction 
Forward
Predicted Peptide Sequence 
MAAYSVPPVEELLSKRVQEMVLHGEEPLGPYICRSGDDVDEKEDIMDTSPIPIIDLNLLSSSTTSDNEREQELEKLGSALSSWGCFQGIA
HGISASLLDKIRQVSREFFNQPMEEKNREVLEDYSEKMKMVTEITSKAMAKSLKLEEKCFLEQFGKQAQLHARFNYYSPCQRPDLVLGLK
PHADGTGYTIILQDEVGLQVLKDGKWYAVPKNPTALLVLMGDQMEIMSNGIFKSPVHRVVSNSRRDRISIAMFYTPELGKEIGPEDELVN
MDRPRIYKKVTDYAETHWKFYQRGMRALHTAPFRTTIYICPPHVVWAWIESXTTTILALHFFHLMLGLAKKKPPF
Predicted Coding Sequence 
ATGGCTGCATATTCAGTTCCACCTGTAGAGGAGTTGCTGTCAAAAAGAGTTCAAGAAATGGTCCTTCATGGGGAGGAGCCACTAGGACCT
TATATTTGCAGAAGTGGTGACGATGTTGATGAAAAAGAAGACATCATGGATACTTCTCCAATTCCTATAATTGATCTAAACCTCCTGTCT
TCTTCAACAACATCAGATAACGAACGCGAACAAGAGTTGGAGAAACTTGGATCAGCTCTATCTTCTTGGGGATGTTTTCAGGGAATAGCA
CATGGGATTTCAGCTTCTTTACTGGACAAAATCCGCCAAGTTTCAAGGGAATTCTTCAACCAGCCAATGGAAGAGAAGAACAGAGAGGTC
TTAGAAGATTATTCTGAGAAAATGAAAATGGTCACAGAAATTACCTCTAAAGCTATGGCAAAGTCGTTGAAGCTGGAAGAAAAGTGCTTC
TTGGAACAATTTGGAAAACAAGCACAACTGCATGCGCGGTTTAACTACTACTCGCCATGTCAGAGGCCTGATCTGGTTCTTGGCTTAAAA
CCCCATGCTGATGGAACAGGATACACAATTATTCTGCAAGATGAAGTAGGACTCCAAGTGCTTAAGGATGGCAAATGGTATGCAGTACCA
AAAAATCCTACAGCTCTGCTTGTTCTCATGGGTGATCAAATGGAGATAATGAGCAATGGAATATTCAAGAGCCCGGTGCATAGGGTAGTG
AGTAATTCAAGGAGGGATAGAATTTCTATCGCAATGTTCTACACGCCTGAATTAGGGAAAGAAATCGGACCAGAAGATGAGTTAGTCAAT
ATGGACAGACCAAGGATATACAAGAAAGTGACAGATTATGCAGAAACTCACTGGAAGTTTTACCAGCGTGGTATGAGAGCACTACACACT
GCACCATTTAGAACTACTATCTATATATGTCCTCCTCATGTTGTTTGGGCATGGATAGAAAGTXCTACAACTACAATTTTGGCTTTACAT
TTTTTTCACCTCATGCTTGGACTCGCGAAGAAAAAGCCACCATTCTAA\
Edits in Original Sequence 
CTAATTGGAAACCCATTGGATAGTGTTACTTGATCATAGCATAAGC(5')ATGGCTGCATATTCAGTTCCACCTGTAGAGGAGTTGCTGT
CAAAAAGAGTTCAAGAAATGGTCCTTCATGGGGAGGAGCCACTAGGACCTTATATTTGCAGAAGTGGTGACGATGTTGATGAAAAAGAAG
ACATCATGGATACTTCTCCAATTCCTATAATTGATCTAAACCTCCTGTCTTCTTCAACAACATCAGATAACGAACGCGAACAAGAGTTGG
AGAAACTTGGATCAGCTCTATCTTCTTGGGGATGTTTTCAGGGAATAGCACATGGGATTTCAGCTTCTTTACTGGACAAAATCCGCCAAG
TTTCAAGGGAATTCTTCAACCAGCCAATGGAAGAGAAGAACAGAGAGGTCTTAGAAGATTATTCTGAGAAAATGAAAATGGTCACAGAAA
TTACCTCTAAAGCTATGGCAAAGTCGTTGAAGCTGGAAGAAAAGTGCTTCTTGGAACAATTTGGAAAACAAGCACAACTGCATGCGCGGT
TTAACTACTACTCGCCATGTCAGAGGCCTGATCTGGTTCTTGGCTTAAAACCCCATGCTGATGGAACAGGATACACAATTATTCTGCAAG
ATGAAGTAGGACTCCAAGTGCTTAAGGATGGCAAATGGTATGCAGTACCAAAAAATCCTACAGCTCTGCTTGTTCTCATGGGTGATCAAA
TGGAGATAATGAGCAATGGAATATTCAAGAGCCCGGTGCATAGGGTAGTGAGTAATTCAAGGAGGGATAGAATTTCTATCGCAATGTTCT
ACACGCCTGAATTAGGGAAAGAAATCGGACCAGAAGATGAGTTAGTCAATATGGACAGACCAAGGATATACAAGAAAGTGACAGATTATG
CAGAAACTCACTGGAAGTTTTACCAGCGTGGTATGAGAGCACTACACACTGCACaCATTTAGAACTACTATCTATATATGTCCTCCTCAT
GTTGTTTGGGCATGGATAGAAAGTXCTACAACTACAATTTTGGCTTTACATTTTTTTCACCTCATGCTTGGACTCGCGAAGAAAAAGCCA
CCATTCTAA\(3')TAGATGAATCATCCAATGATGATTTGGTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan