ESTScan Details for Unigene SGN-U248351

Score 
447
Direction 
Forward
Predicted Peptide Sequence 
MGXAGITSAFIRTQFPSVDIPLENEVLSVPNGYNAPQQVHITQGDYDGEAVIISWVTADEPGSSEVRYGLSEGKYDFTVEGTLNNYTFYK
YESGYIHQCLITGLQYDTKYYYEIGKGDSARKFWFETPXKVDPDASYKFGIIGDPW
Predicted Coding Sequence 
ATGGGAGXTGCTGGTATAACAAGTGCATTCATTCGAACTCAGTTTCCGTCTGTTGATATTCCCCTTGAAAATGAAGTACTTTCAGTTCCA
AATGGTTATAACGCTCCACAGCAAGTGCATATTACACAAGGTGACTATGATGGGGAAGCTGTCATTATTTCATGGGTAACTGCTGATGAA
CCAGGGTCTAGCGAAGTGCGATATGGCTTATCTGAAGGGAAATATGATTTTACTGTTGAAGGGACTCTAAATAACTACACATTCTACAAG
TACGAGTCTGGTTACATACATCAGTGCCTTATAACTGGCCTTCAGTATGACACAAAGTACTACTATGAAATTGGAAAAGGAGATTCTGCA
CGGAAGTTTTGGTTTGAAACTCCTNNCAAAGTTGATCCAGATGCTTCTTACAAATTTGGCATCATAGGTGACCCTTGG\
Edits in Original Sequence 
CAAATGTTCCCTTGAATATTCATGTTTTTTTTAAACTTGATTTGTAGTAATTCTACTATTTCAATTCAAAAATATCATCTTTTTGATATA
CCCATTTCAAAAAGATTACATTTTTAGTTCAGAAATATCATAGATTTTTGCTGGTTCACTCCCTTGTTGTTTCAGCCTTCAAAGTCAATT
ATAACTGGTCTTGCCTGAGTTCTCTCTGATCGAGCAGTGCTTATCTTGGAAGTTAGTGGAGAGGAGACAATGTTGCTTTATATCTTCTTT
TTGTTATCTCTCTTTTTGACATTTATAGACA
(5')ATGGGAGXTGCTGGTATAACAAGTGCATTCATTCGAACTCAGTTTCCGTCTGTTG
ATATTCCCCTTGAAAATGAAGTACTTTCAGTTCCAAATGGTTATAACGCTCCACAGCAAGTGCATATTACACAAGGTGACTATGATGGGG
AAGCTGTCATTATTTCATGGGTAACTGCTGATGAACCAGGGTCTAGCGAAGTGCGATATGGCTTATCTGAAGGGAAATATGATTTTACTG
TTGAAGGGACTCTAAATAACTACACATTCTACAAGTACGAGTCTGGTTACATACATCAGTGCCTTATAACTGGCCTTCAGTATGACACAA
AGTACTACTATGAAATTGGAAAAGGAGATTCTGCACGGAAGTTTTGGTTTGAAACTCCTNNCAAAGTTGATCCAGATGCTTCTTACAAAT
TTGGCATCATAGGTGACCCTTGG\(3')TCAAACATATAATTCTCTTTCAACTCTTCAGCATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan