ESTScan Details for Unigene SGN-U248565

Score 
298
Direction 
Forward
Predicted Peptide Sequence 
MWKTGRKTIAGSAMGGMKETQEMLDFAAKHNITPDVEVVAMDYVNTALERLVKSDVKYRFVLDVGKKMNNV
Predicted Coding Sequence 
ATGTGGAAAACAGGAAGGAAGACAATTGCTGGGAGTGCAATGGGAGGAATGAAAGAGACTCAAGAAATGTTAGATTTTGCAGCAAAGCAT
AACATAACCCCAGATGTTGAAGTCGTAGCGATGGACTACGTGAATACAGCGTTGGAACGCCTTGTTAAATCCGATGTCAAGTATCGATTC
GTGCTAGATGTGGGCAAAAAAATGAACAATGTTTAA\
Edits in Original Sequence 
GTCCTAATGTTTATAGTTCGATTTTGTATATTGGTCATGATACATCAATATACGTTCAAATTTAGTCTTAAATATAAAATATGCACGTCT
AAACACCTCAACTCATTTTCATTGTGTCAGTTGAACATTCTAACTTACAAAACGATCATCTAGACACTACTAGAAACAAAGGTTTTTCCC
ACGGCTGATCAGTTGGAAAGTTATGCTATAGATCATAATTTTCCAACCAAACCAACTTACTAGAAAAATGCATGGTGAAACAAATTTTCA
ATGAAATAGTGAGAACTTTCTATATGAAAACATTATTATTTTTTCCCCCACTGATTCAATCAAAATATCTGTCGGAATAGCCACACATTT
TCCAATGGGAGAATAGTGATTGTTTAGTAGTGAGACACCTCTAAAATTTATGTGTCACGTCAGCATAAGTGTCTAAGAGACACAGTGAGA
ACGAGTTGGAGTGTTTAGTTGTCAATTGAGACCAAGTTGAGATGTCAAGATATGCACTTTCAAAGTTGGAATATAATGTTTACTTGTCAT
TTAAGGCCAAGTTTAAGTGTCTGTTTATATATTATGCCAGATTATCGTTGTTGTTACGTACTCTTTAAACTATTTAAGTTCATATTGAAG
TATAAGTGTATA
(5')ATGTGGAAAACAGGAAGGAAGACAATTGCTGGGAGTGCAATGGGAGGAATGAAAGAGACTCAAGAAATGTTAGA
TTTTGCAGCAAAGCATAACATAACCCCAGATGTTGAAGTCGTAGCGATGGACTACGTGAATACAGCGTTGGAACGCCTTGTTAAATCCGA
TGTCAAGTATCGATTCGTGCTAGATGTGGGCAAAAAAATGAACAATGTTTAA\(3')TCTCAAAACCAATTTTTTTTGGTTCTTGAAAAT
CATTGTTGATCTTCTTGATGTTGTGTGTGTTTTTTAAGATATCTTGTTTTAGTATGTTAGTGTCTTTGCTTAGTTATGTAAGTTGTTCAC
AACTTGAAAGACAAATAATTTGTTGTTTGCCTTATTTTATCCCAATCTTTAATGGCCCGCTCTGAAAAGCTAAGTTTTTCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan