ESTScan Details for Unigene SGN-U248574

Score 
876
Direction 
Forward
Predicted Peptide Sequence 
PSSPMASLSLISPHSPSSSSSTLRHSSIIGTRLPSIFLRNPTIRIRSTTPSIKAFSAPVPSPLTQDELKKLAADKAVEYVKSGMVLGLGT
GSTAAFVVAKLGELLSSGQLTNIVGVPTSKRTEEQALSLNIPLSTLDDHPHIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAASDKFV
VVVDDSKLVSGLGGSGLAMPVEVVQFCWKYNLVRLQELFKEEGVDAKLRLDGNGKPYVTDNSNYIVDLYFKTPIXDSAAAGKEIASFEGV
VEHGLFLDMTTAVIIAGKEGVSVKSK
Predicted Coding Sequence 
XCTCCATCATCACCCATGGCTTCCTTATCCCTAATCTCACCTCACTCACCTTCTTCTTCATCTTCTACTCTCCGCCACAGTTCTATCATC
GGCACCCGCCTTCCTTCCATCTTCTTGCGCAACCCCACTATCCGCATTCGCTCCACAACCCCTTCAATTAAAGCCTTCTCTGCCCCCGTT
CCATCACCTTTAACCCAAGATGAACTCAAGAAACTCGCAGCCGATAAGGCCGTTGAGTATGTCAAAAGTGGAATGGTCCTTGGTCTAGGC
ACTGGGTCAACAGCAGCTTTCGTTGTCGCTAAATTAGGTGAGCTTCTTTCATCTGGGCAACTCACGAACATTGTAGGAGTTCCCACTTCA
AAGCGTACTGAAGAACAAGCTTTGTCGCTCAACATCCCGTTATCTACCCTTGACGACCACCCACATATTGATCTAGCTATTGATGGTGCT
GATGAGGTCGACCCGAATCTCGACCTAGTCAAGGGTCGAGGAGGAGCTCTGTTAAGAGAGAAGATGGTGGAGGCGGCGTCCGATAAGTTC
GTTGTTGTGGTAGATGATTCGAAGCTTGTTTCGGGTCTTGGTGGATCCGGGTTGGCTATGCCAGTTGAGGTGGTGCAGTTTTGTTGGAAG
TACAATTTGGTTAGGTTACAGGAATTGTTTAAGGAAGAGGGTGTTGATGCAAAGTTGAGATTGGATGGTAATGGGAAGCCATATGTGACC
GATAACTCTAATTATATTGTGGATTTGTATTTCAAGACTCCTATTANGGATTCTGCTGCTGCTGGGAAGGAGATTGCGTCTTTCGAAGGG
GTGGTGGAGCATGGATTGTTCTTGGATATGACCACTGCTGTTATCATTGCTGGGAAGGAAGGAGTCAGTGTCAAGAGCAAGTGA\
Edits in Original Sequence 
(5')XCTCCATCATCACCCATGGCTTCCTTATCCCTAATCTCACCTCACTCACCTTCTTCTTCATCTTCTACTCTCCGCCACAGTTCTAT
CATCGGCACCCGCCTTCCTTCCATCTTCTTGCGCAACCCCACTATCCGCATTCGCTCCACAACCCCTTCAATTAAAGCCTTCTCTGCCCC
CGTTCCATCACCTTTAACCCAAGATGAACTCAAGAAACTCGCAGCCGATAAGGCCGTTGAGTATGTCAAAAGTGGAATGGTCCTTGGTCT
AGGCACTGGGTCAACAGCAGCTTTCGTTGTCGCTAAATTAGGTGAGCTTCTTTCATCTGGGCAACTCACGAACATTGTAGGAGTTCCCAC
TTCAAAGCGTACTGAAGAACAAGCTTTGTCGCTCAACATCCCGTTATCTACCCTTGACGACCACCCACATATTGATCTAGCTATTGATGG
TGCTGATGAGGTCGACCCGAATCTCGACCTAGTCAAGGGTCGAGGAGGAGCTCTGTTAAGAGAGAAGATGGTGGAGGCGGCGTCCGATAA
GTTCGTTGTTGTGGTAGATGATTCGAAGCTTGTTTCGGGTCTTGGTGGATCCGGGTTGGCTATGCCAGTTGAGGTGGTGCAGTTTTGTTG
GAAGTACAATTTGGTTAGGTTACAGGAATTGTTTAAGGAAGAGGGTGTTGATGCAAAGTTGAGATTGGATGGTAATGGGAAGCCATATGT
GACCGATAACTCTAATTATATTGTGGATTTGTATTTCAAGACTCCTATTANGGATTCTGCTGCTGCTGGGAAGGAGATTGCGTCTTTCGA
AGGGGTGGTGGAGCATGGATTGTTCTTGGATATGACCACTGCTGTTATCATTGCTGGGAAGGAAGGAGTCAGTGTCAAGAGCAAGTGA\
(3')AATATTCATCAATTTTAGCTCCCAACTGGTGAGGTCTGAACAACTTTAACTTCTGTTTTGAGTGGAAATTTTAGACTTCATTTTCGT
TTTGAGGAAATAGGAGTTGATTGTTGTAACATTAATAAGTTTTGGCATTTTTTTTTGGAGATGTTTAGTAATAATACTCCCATCTGAATG
TAATTTGTATATTAGAATGGAAAAGAAATGTTTTTTTGTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan