ESTScan Details for Unigene SGN-U248597

Score 
1139
Direction 
Forward
Predicted Peptide Sequence 
MGEKKEETKAEVAEKKNDAGEKKSGAGDAAGKKDAGPTAIVLKLDLHCEGCAKKVKRFIRHFEGVEDVKTDCDGGKLTVKGNVDXGMAPG
ESSDEDEEDGGARLPQPKKDAGAGDKKPDEKKAEEKKPEDKKPKEPQVSTVVLKIRLHCDGCAHKIKRIIKKIDGVEEVKVDSEKDLVTV
KGTMDLKKLIPYLKDKLKRNVEIVPPKKDDGGGEKKEGGGEKKEKEGGGGVKKEKEGGGGEKKEKEGGGDKKVESNKKKEGEPKAEGSKG
VETKSX
Predicted Coding Sequence 
ATGGGTGAGAAAAAAGAAGAAACTAAAGCAGAGGTAGCAGAGAAGAAGAATGACGCCGGAGAAAAAAAGTCCGGCGCCGGTGACGCCGCC
GGGAAAAAGGATGCCGGTCCCACCGCCATAGTTTTAAAACTCGATTTGCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTTTCATTCGC
CATTTCGAAGGTGTGGAGGATGTGAAGACAGATTGTGACGGTGGAAAATTGACGGTGAAAGGGAACGTGGACXCCGGCATGGCTCCGGGA
GAAAGTAGCGATGAAGACGAAGAAGACGGTGGTGCTCGTCTTCCTCAGCCCAAAAAGGACGCCGGCGCCGGGGATAAAAAGCCCGATGAG
AAAAAGGCAGAAGAGAAAAAACCCGAAGATAAGAAGCCCAAAGAGCCACAAGTAAGTACAGTGGTGTTGAAGATTCGATTGCATTGTGAT
GGATGTGCACACAAAATAAAGAGAATTATAAAGAAAATTGATGGGGTAGAAGAAGTCAAAGTAGATTCGGAAAAAGATTTGGTCACGGTA
AAGGGCACGATGGACTTAAAGAAATTAATTCCCTATTTGAAAGATAAACTGAAAAGAAATGTAGAAATTGTCCCACCTAAGAAAGATGAT
GGAGGTGGCGAAAAGAAAGAAGGTGGTGGAGAGAAGAAAGAGAAAGAAGGCGGCGGTGGTGTGAAGAAAGAGAAAGAAGGTGGTGGTGGT
GAGAAGAAAGAGAAAGAAGGGGGCGGTGATAAGAAGGTCGAGAGTAATAAGAAAAAAGAGGGTGAACCAAAAGCCGAAGGAAGTAAAGGT
GTGGAGACAAAGTCTGXX\
Edits in Original Sequence 
TTCATTCTATAATTTCGTCTATAATCCATTTTCATTTTTCAA(5')ATGGGTGAGAAAAAAGAAGAAACTAAAGCAGAGGTAGCAGAGAA
GAAGAATGACGCCGGAGAAAAAAAGTCCGGCGCCGGTGACGCCGCCGGGAAAAAGGATGCCGGTCCCACCGCCATAGTTTTAAAACTCGA
TTTGCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTTTCATTCGCCATTTCGAAGGTGTGGAGGATGTGAAGACAGATTGTGACGGTGG
AAAATTGACGGTGAAAGGGAACGTGGACXCCGGCATGGCTCCGGGAGAAAGTAGCGATGAAGACGAAGAAGACGGTGGTGCTCGTCTcTC
CTCAGCCCAAAAAGGACGCCGGCGCCGGGGATAAAAAGCCCGATGAGAAAAAGGCAGAAGAGAAAAAACCCGAAGATAAGAAGCCCAAAG
AGCCACAAGTAAGTACAGTGGTGTTGAAGATTCGATTGCATTGTGATGGATGTGCACACAAAATAAAGAGAATTATAAAGAAAATTGATG
GGGTAGAAGAAGTCAAAGTAGATTCGGAAAAAGATTTGGTCACGGTAAAGGGCACGATGGACTTAAAGAAATTAATTCCCTATTTGAAAG
ATAAACTGAAAAGAAATGTAGAAATTGTCCCACCTAAGAAAGATGATGGAGGTGGCGAAAAGAAAGAAGGTGGTGGAGAGAAGAAAGAGA
AAGAAGGCGGCGGTGGTGTGAAGAAAGAGAAAGAAGGTGGTGGTGGTGAGAAGAAAGAGAAAGAAGGGGGCGGTGATAAGAAGGTCGAGA
GTAATAAGAAAAAAGAGGGTGAACCAAAAGCCGAAGGAAGTAAAGGTGTGGAGACAAAGTCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan