ESTScan Details for Unigene SGN-U248645

Score 
453
Direction 
Forward
Predicted Peptide Sequence 
SWRVKYVNSHHRLVHSTPTEQTGFEILIFGVMKKKMVKAGETETKKKAKCFKDKRKNMQRLGGGRGGLSLEAFANAKTKTNTYNPAIXKY
SYDTGELNYCFYRKNNSADSESMAETVGSNSIAIYVVSVIVLFFLCRKAKGVHKNAKYVNKYKRIVKQQQGEPSGSGSARQLEDEEGRRN
KKNSARSLREIYERKREEDDKARMETEATILARKEERQRAESRRKEVREKMFKKTKSGQPVMKYRIEHILETLQGSKV
Predicted Coding Sequence 
XGTTCGTGGAGGGTGAAATACGTAAACTCTCATCATCGTCTTGTTCATTCGACTCCAACTGAACAAACTGGGTTTGAGATCCTAATTTTT
GGCGTTATGAAGAAGAAAATGGTAAAGGCGGGTGAGACGGAAACGAAGAAGAAAGCAAAATGTTTCAAGGATAAGAGGAAGAATATGCAA
AGATTAGGAGGAGGAAGAGGAGGCTTATCATTGGAAGCATTTGCAAACGCCAAAACCAAGACCAACACTTACAACCCTGCCATCATXAAG
TATTCTTACGACACTGGGGAATTAAATTATTGCTTTTACCGAAAAAATAACTCTGCCGATTCTGAATCTATGGCTGAAACAGTTGGTTCT
AATAGCATAGCXATATATGTTGTATCTGTAATTGTGCTTTTCTTTTTGTGCAGAAAAGCAAAGGGAGTTCATAAGAACGCCAAATATGTA
AATAAATATAAGAGGATAGTTAAGCAGCAACAAGGAGAGCCTTCTGGTTCTGGTTCTGCAAGACAACTAGAGGATGAAGAAGGGAGAAGA
AATAAGAAGAATAGTGCTAGAAGCCTAAGAGAAATATATGAGAGAAAACGCGAGGAGGATGACAAGGCAAGGATGGAGACAGAGGCCACT
ATTCTAGCAAGGAAAGAAGAAAGGCAGAGAGCTGAATCTCGAAGGAAAGAAGTAAGGGAGAAAATGTTCAAGAAAACCAAATCAGGCCAA
CCAGTCATGAAGTACAGAATAGAACATATTTTGGAAACACTTCAAGGATCAAAAGTATAA\
Edits in Original Sequence 
(5')XGTTCGTGGAGGGTGAAATACGTAAACTCTCATCATCGTCTTGTTCATTCGACTCCAACTGAACAAACTaGGGTTTGAGATCCTAA
TTTTTGGCGTTATGAAGAAGAAAATGGTAAAGGCGGGTGAGACGGAAACGAAGAAGAAAGCAAAATGTTTCAAGGATAAGAGGAAGAATA
TGCAAAGATTAGGAGGAGGAAGAGGAGGCTTATCATTGGAAGCATTTGCAAACGCCAAAACCAAGACCAACACTTACAACCCTGCCATCA
TXAAGTATTCTTACGACACTGGGGAATTAAATTATTGCTTTTACCGAAAAAATAACTCTGCCGATTCTGAATCTATGGtCTGAAACAGTT
GGTTCTAATAGCATAGCXATATATGTTGTATCTGTAATTGTGCTTTTCTTTTTGTGCAGAAAAGCAAAGGGAGTTCtATAAGAACGCCAA
ATATGTAAATAAATATAAGAGGATAGTTAAGCAGCAACAAGGAGAGCCTTCTGGTTCTGGTTCTGCAAGACAACTAGAGGATGAAGAAGG
GAGAAGAAATAAGAAGAATAGTGCTAGAAGCCTAAGAGAAATATATGAGAGAAAACGCGAGGAGGATGACAAGGCAAGGATGGAGACAGA
GGCCACTATTCTAGCAAGGAAAGAAGAAAGGCAGAGAGCTGAATCTCGAAGGAAAGAAGTAAGGGAGAAAATGTTCAAGAAAACCAAATC
AGGCCAACCAGTCATGAAGTACAGAATAGAACATATTTTGGAAACACTTCAAGGATCAAAAGTATAA\(3')GGAATATGACGCGAGCAG
TAACATCAAAGACACAAGTGTGTATGGATGTAAAAAGTTTAAAGAAAAAACTCTTCTTGTTCCAATTAATATTTTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan