ESTScan Details for Unigene SGN-U248677

Score 
328
Direction 
Forward
Predicted Peptide Sequence 
ATDLSFVNGVLXMKTPNPDFSSNQSHYSNPIPIRKPKPGLYTDPESSSPSLFLFFSLLFRSSISLLSPSDPSSYGSLFPSLSDLLLLLPS
QVVTSGSDSENPFKTRPKDDLSDTEPDTKKSNRRSNRPTKKNVDFEPVLATHYDLKPEKTNGSVANSKNSNGSVANLEKKVGDGVWNEGD
EELLRKMMGKHPVGKPGRWEAIADGFNGRYRVESVIKKSKELGEKKMSDGDSYXEFLKDRKTVDKRSEGGNEADFX
Predicted Coding Sequence 
XXGGCGACTGACCTTTCGTTTGTCAATGGAGTTCTTAXGATGAAGACGCCAAACCCAGATTTCTCTTCCAATCAAAGCCACTACAGCAAT
CCAATTCCGATCCGGAAACCCAAACCCGGTCTCTATACCGACCCGGAATCATCATCTCCATCTCTCTTTCTGTTCTTTTCTTTGCTCTTT
CGATCCTCTATTTCTCTTTTGAGCCCTTCGGATCCATCTTCTTATGGATCTCTCTTTCCCTCCTTGTCGGACCTTTTGCTCCTTCTTCCG
TCACAGGTGGTGACATCCGGGTCGGACTCGGAGAACCCATTCAAGACCCGXCCTAAAGATGATCTTTCTGATACCGAACCCGATACGAAA
AAATCAAACAGAAGATCTAACAGACCCACCAAGAAAAACGTTGACTTTGAGCCTGTGTTAGCTACCCATTATGATCTAAAGCCGGAGAAA
ACTAATGGGTCGGTGGCAAATTCGAAGAATAGTAATGGGTCGGTTGCGAATCTGGAGAAAAAAGTGGGGGATGGTGTGTGGAATGAAGGG
GATGAGGAGTTGTTGAGGAAGATGATGGGGAAGCATCCGGTGGGGAAACCGGGGCGGTGGGAGGCGATAGCAGATGGATTTAACGGGAGA
TACAGAGTGGAAAGTGTGATTAAGAAATCTAAAGAATTGGGTGAGAAGAAAATGAGTGATGGGGATTCCTATNCAGAGTTTTTGAAGGAC
AGGAAAACAGTTGATAAGAGATCTGAGGGTGGAAATGAGGCTGATTTCGXX\
Edits in Original Sequence 
(5')XXGGCGACTGACCTTTCGTTTGTCAATGGAGTTCTTAXGATGAAGACGCCAAACCCAGATTTCTCTTCCAATCAAAGCCACTACAG
CAATCCAATTCCGATCCGGAAACCCAAACCCGGTCTCTATACCGACCCGGAATCATCATCTCCATCTCTCTTTCTGTTCTTTTCTTTGCT
CTTTCGATCCTCTATTTCTCTTTTGAGCCCTTCGGATCCATCTTCTTATGGATCTCTCTTTCCCTCCTTGTCGGACCTTTTGCTCCTTCT
TCCGTCACAGGTGGTGACATCCGGGTCGGACTCGGAGAACCCATTCAAGACCCGXCCTAAAGATGATCTTTCTGATACCGAACCCGATAC
GAAAAAATCAAACAGAAGATCTAACAGACCCACCAAGAAAAACGTTGACTTTGAGCCTGTGTTAGCTACCCATTATGATCTAAAGCCGGA
GAAAACTAATGGGTCGGTGGCAAATTCGAAGAATAGTAATGGGTCGGTTGCGAATCTGGAGAAAAAAGTGGGGGATGGTGTGTGGAATGA
AGGGGATGAGGAGTTGTTGAGGAAGATGATGGGGAAGCATCCGGTGGGGAAACCGGGGCGGTGGGAGGCGATAGCAGATGGATTTAACGG
GAGATACAGAGTGGAAAGTGTGATTAAGAAATCTAAAGAATTGGGTGAGAAGAAAATGAGTGATGGGGATTCCTATNCAGAGTTTTTGAA
GGACAGGAAAACAGTTGATAAGAGATCTGAGGGTGGAAATGAGGCTGATTTCGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan