ESTScan Details for Unigene SGN-U248820

Score 
795
Direction 
Forward
Predicted Peptide Sequence 
SFXTLLAQIIEPVKKKKKMMMMEGAIAISRFSASNTPLLIRSMATQKPTPSTTKTVTSKKTTTVFPVGEKPRPGNSSSTPTVKLLTRVEQ
LRLLTKAEKAGLLSAAEKSGLSLSAIERLGLLSKAEELGILSAATDPSTPSALFSLSLGLLAVGPVCVYLVPEDYPWQIGLQVVVALLSV
VGGSAAFGASNLVSTLQKVN
Predicted Coding Sequence 
XTTAGCTTTGAXACTCTTTTAGCACAAATAATTGAACCAGTGAAAAAGAAGAAGAAGATGATGATGATGGAGGGCGCCATTGCGATTTCA
CGTTTTTCTGCTTCAAACACACCACTTCTCATCCGATCCATGGCAACACAAAAACCAACTCCATCTACTACCAAAACCGTTACTTCTAAA
AAGACAACAACTGTATTTCCAGTAGGGGAGAAACCTCGGCCAGGCAATTCTTCATCTACACCAACGGTGAAGTTATTGACAAGAGTGGAG
CAATTGCGGCTGTTAACTAAAGCAGAGAAAGCTGGTTTACTATCAGCTGCTGAGAAATCTGGACTCTCTTTGTCGGCAATTGAAAGACTT
GGTCTTCTTTCCAAAGCCGAAGAATTGGGGATTCTTTCAGCAGCTACTGACCCTTCAACCCCATCAGCACTCTTCAGTTTGAGCTTGGGA
TTGCTTGCTGTTGGCCCTGTTTGTGTGTATCTGGTGCCTGAAGATTACCCTTGGCAAATTGGTTTGCAGGTTGTGGTTGCTCTACTTTCT
GTTGTTGGTGGCTCTGCAGCTTTTGGAGCCTCAAATCTTGTTTCCACTTTGCAGAAAGTAAATTGA\
Edits in Original Sequence 
(5')XTTAGCTTTGAXACTCTTTTAGCACAAATAATTGAACCAGTGAAAAAGAAGAAGAAGATGATGATGATGGAGGGCGCCATTGCGAT
TTCACGTTTTTCTGCTTCAAACACACCACTTCTCATCCGATCCATGGCAACACAAAAACCAACTCCATCTACTACCAAAACCGTTACTTC
TAAAAAGACAACAACTGTATTTCCAGTAGGGGAGAAACCTCGGCCAGGCAATTCTTCATCTACACCAACGGTGAAGTTATTGACAAGAGT
GGAGCAATTGCGGCTGTTAACTAAAGCAGAGAAAGCTGGTTTACTATCAGCTGCTGAGAAATCTGGACTCTCTTTGTCGGCAATTGAAAG
ACTTGGTCTTCTTTCCAAAGCCGAAGAATTGGGGATTCTTTCAGCAGCTACTGACCCTTCAACCCCATCAGCACTCTTCAGTTTGAGCTT
GGGATTGCTTGCTGTTGGCCCTGTTTGTGTGTATCTGGTGCCTGAAGATTACCCTTGGCAAATTGGTTTGCAGGTTGTGGTTGCTCTACT
TTCTGTTGTTGGTGGCTCTGCAGCTTTTGGAGCCTCAAATCTTGTTTCCACTTTGCAGAAAGTAAATTGA\(3')AATGTAAGCTTTCTC
TGTTAGAAAATTTCTATTATATATAGTATAAATGTTTATTTTGCTCAATCTTGATTATTCTTTGTTGATCCCTTGCAATCTAAGATATAC
ATTGTCCTTCCCGATTGAGCATTGAGTCATTACGACATCAAATCCTTGTCTGGATAAAGAATCTTGATCTGCAGTTTTCATTTCAGCAAT
ATATGTAGTTCTGCAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan